KEGG   Campylobacter avium: CAV_0026Help
Entry
CAV_0026          CDS       T05533                                 

Definition
(GenBank) 23S rRNA pseudouridine synthase, RluD family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cavi  Campylobacter avium
Brite
KEGG Orthology (KO) [BR:cavi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cavi03009]
    CAV_0026
Enzymes [BR:cavi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CAV_0026
Ribosome biogenesis [BR:cavi03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CAV_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ASQ29711
UniProt: A0A222MV93
Position
complement(24671..25576)
Genome map
AA seq 301 aa AA seqDB search
MPYIKKELKLRNLRAYELLMQEQNISMSRAQRLIDKKRLFCNDVPVSKKNEFLSGKIELL
VYENKAQGVEVVFEEDDFAVLEKASGVLSHPNGRHCKYSLCDEIWALWGEQACVAHRLDK
QTSGLILVAKNKNAQIELKKMFENKEIKKQYLALVKGETPREFTVNKALALADDYDDVKI
RVRPCDSGKKAISLFTRLEYFKDLDASFLLCKPLTGRQHQLRAHLFYSGYRILGDCLYGL
EKGDIERILDELVSEKELLKLCLATRLCLHSYNLSFEFKGKFYDIYSKKDAKKDFLKALH
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccctacataaaaaaggagctcaaactccggaatttaagagcttacgagcttcttatg
caagaacaaaatatatctatgtcccgtgctcaaagattgatagataaaaaaagattattt
tgtaatgatgtgccggtgagcaaaaaaaacgagtttttaagcggcaagatagaattgctt
gtatatgaaaacaaggcacaaggcgtggaagtagtgtttgaagaagatgattttgccgtg
cttgaaaaggctagtggcgttttaagccacccaaatggcagacactgcaaatacagtctc
tgcgatgaaatttgggctctttggggtgagcaagcttgtgtggcacacagacttgataag
caaacaagtggtcttatattagttgcaaaaaataaaaatgcacagattgagcttaaaaag
atgtttgaaaacaaagagataaaaaagcagtatttagccctagttaagggcgaaactcct
agggaattcacggttaataaagctttggctcttgctgatgattacgatgatgtaaaaatt
agagtaaggccttgtgatagtgggaaaaaggctatttcactctttacaaggcttgagtat
tttaaggatttagacgcttcttttttgctttgcaaaccacttacaggcagacaacatcag
ctaagagcgcatttattttacagcggatatagaattttaggagactgtttgtatggttta
gaaaaaggtgatattgaaagaattttagatgagcttgtaagcgaaaaagaacttttaaaa
ttatgcctagcaaccaggctttgcttgcattcttataatcttagctttgaatttaaggga
aaattttatgatatatactcaaaaaaagatgcaaaaaaggactttttaaaagccttgcat
ttgtaa

DBGET integrated database retrieval system