KEGG   Campylobacter avium: CAV_0418Help
Entry
CAV_0418          CDS       T05533                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cavi  Campylobacter avium
Pathway
cavi00020  Citrate cycle (TCA cycle)
cavi00620  Pyruvate metabolism
cavi01100  Metabolic pathways
cavi01110  Biosynthesis of secondary metabolites
cavi01120  Microbial metabolism in diverse environments
cavi01130  Biosynthesis of antibiotics
cavi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cavi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAV_0418 (mqo)
   00620 Pyruvate metabolism
    CAV_0418 (mqo)
Enzymes [BR:cavi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CAV_0418 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_9 Pyr_redox_2 Pyr_redox_3 NAD_binding_8 K_oxygenase 3Beta_HSD Thi4 HI0933_like Amino_oxidase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ASQ30085
UniProt: A0A222MW12
Position
complement(414799..416136)
Genome map
AA seq 445 aa AA seqDB search
MKEFDVVVVGAGISGAALFYELARYTDIKNIALIEKYDSIATLNSRATSNSQTIHCGDIE
TNYTIEKARKVKVNADMVAKYASKQEGKPFVFSHQKMVLAVGDEECKYLKNRYEEFKELY
PYVKFFDKQKVKELEPRVVLAENSKGDRKESIVAMGALQGDSYTTIDFGKMAQSLVDNAL
KEDKNTFVEFNQEVIKIEQKDGHFVINTKSGAKYHSKAVVVNAGAHSLFLAHRMGVGLDK
SCWPVAGSFYLTKQKLLNGKVYTVQNPKLPFAALHGDPDLMADMNTRFGPTALVIPKLER
YHGLKSMWEFFETLKFDAKVAKITLGMLKDKTVGMYIFSNYLYELPLINKRLFAKSIKKI
VPSIKASEIEYAEGFGGVRPQVIDKTRGELMLGEASITDVKGAIFNMTPSPGATSCLGNA
KKDAQSVCEYLGAKFDEDKFNSDFA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttgatgtagtggtagttggtgctggaatttcgggtgcggctttattttac
gagcttgctagatacactgatataaaaaatatagcattgatagaaaagtatgattctata
gctacgcttaatagcagggctactagcaactcacagactatacattgcggagacatagaa
acaaattacactatagaaaaggctagaaaagttaaggtaaatgccgatatggtggcaaaa
tacgcctccaaacaagagggcaagccctttgttttttctcatcaaaaaatggtcttagct
gttggggatgaggagtgcaagtatcttaaaaacagatacgaagaatttaaagaattatat
ccttatgtgaaattttttgacaagcaaaaggtaaaagagctagaaccaagggttgtttta
gctgaaaattcaaaaggagatagaaaagaaagcatagtggctatgggtgccttgcaaggc
gatagttacaccaccatagactttggcaaaatggctcaaagcttggtggataatgcttta
aaagaggataaaaatacctttgttgaatttaatcaagaagttattaagatagagcaaaaa
gacggacattttgttataaatacaaaatcaggtgcaaaatatcactcaaaggccgttgtt
gtaaatgctggagcgcattctttgtttttagctcacagaatgggcgttggtttagataag
tcttgctggcctgtggcaggtagcttttatctaaccaagcaaaaacttttaaatggcaag
gtttatacggtgcaaaatcctaagcttccttttgctgccttgcatggagatcctgattta
atggctgatatgaatactcgctttgggccaaccgctcttgttataccaaagcttgagaga
tatcacggcttaaagtctatgtgggagttttttgaaacccttaaatttgacgctaaggta
gctaagataactcttggcatgctaaaggataaaaccgttggtatgtatatcttttcaaac
tatttgtatgagcttcctctaataaataaaagactttttgcaaagagtataaaaaagata
gtgcctagcataaaagcaagtgaaatagaatatgccgaaggttttggcggggttaggcct
caagttatagacaaaacaaggggcgaattaatgctaggagaagctagtatcacagatgta
aaaggagcgatttttaatatgactccaagccctggtgctacttcttgccttggcaatgcc
aaaaaagatgcacaaagcgtttgtgagtatttgggcgctaaatttgatgaggataaattt
aatagcgattttgcttag

DBGET integrated database retrieval system