KEGG   Campylobacter avium: CAV_1060Help
Entry
CAV_1060          CDS       T05533                                 

Gene name
cfiR
Definition
(GenBank) PAS domain-containing transcriptional regulator, YheO family
Organism
cavi  Campylobacter avium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_6 HTH_22 DNA_PPF HTH_29
Motif
Other DBs
NCBI-ProteinID: ASQ30712
UniProt: A0A222MYT1
Position
1049682..1050341
Genome map
AA seq 219 aa AA seqDB search
MRAEKKEHFIKLCKFLGQVLGKRYEVVFHVIEESGAYIAAIENNQVSGRTTNSPLTAFAS
ELVQNKSYLDKDFLCGYKAMVNKDKMVRGSTFFIKDKDKLEGILCINYDTSEMRDVVAKI
IDIEKLDDMSSILNLKQEDDNNVEVLNHSIEEILTQYVDVKYLESDFLLTTEQKQSIISK
LYKKGVFNVKGAISVVAKFLKLSEPSVYRYLGNVKKDMK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagagcggaaaaaaaagaacattttattaaactttgcaaatttttaggacaggtttta
ggaaaaagatatgaggtagtttttcacgtgatagaagaaagcggtgcttatatagctgct
attgagaataatcaagtaagcggcagaaccacaaattcgcctcttacagcctttgctagc
gagctagtgcaaaataaaagttatttggataaggattttttgtgcggttacaaggctatg
gtaaataaagataagatggtaagaggctctaccttttttataaaggataaggataagctt
gagggcatactttgcataaactatgataccagcgagatgagagatgtggtagctaagata
atagatatagaaaagctagatgatatgtcatcaattttaaatttaaaacaagaagatgat
aataatgtagaggttttaaaccactctatagaagaaattttaacccaatatgtagatgta
aaatacctagaatctgactttttactaacaacagagcaaaagcaaagcattataagtaag
ctctataaaaaaggcgtttttaatgtaaaaggagcaattagcgtggtggctaagttttta
aaactatcggagcctagtgtttataggtatttaggcaatgtaaaaaaagatatgaaataa

DBGET integrated database retrieval system