KEGG   Campylobacter avium: CAV_1604Help
Entry
CAV_1604          CDS       T05533                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cavi  Campylobacter avium
Pathway
cavi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cavi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CAV_1604 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cavi03011]
    CAV_1604 (rplV)
Ribosome [BR:cavi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CAV_1604 (rplV)
  Bacteria
    CAV_1604 (rplV)
  Archaea
    CAV_1604 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ASQ31203
UniProt: A0A222MYY1
Position
1609707..1610108
Genome map
AA seq 133 aa AA seqDB search
MSRALIKYIRLSPTKARLIAREIQGMNAELALATLKFTPNRGARYIANAISSAVANGGFE
ANEVVVSSCRIDAGAVLKRFRPRARGSASRIRKPTAHILVEVSKEVKKEDKKDVKDEKKA
KTTTKKVAKKKEE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagctttgattaaatacataagattatctcctacaaaagcaagattaatagca
agggaaattcaaggcatgaatgcagagctagccctagctaccttaaaattcacaccaaac
agaggtgcaagatatatagcaaatgctatctcaagtgcggttgcaaatggtggctttgag
gcaaatgaagttgtagttagctcttgtaggatagatgctggtgctgttttaaaaagattt
agaccaagagcaagaggtagcgcaagtcgcattagaaagcctacagctcacatcttagta
gaggtatcaaaagaagtaaaaaaagaagataaaaaggatgtaaaagatgaaaaaaaagca
aaaactactactaaaaaagtagcgaaaaagaaggaagagtag

DBGET integrated database retrieval system