KEGG   Carnobacterium inhibens: Q783_01590Help
Entry
Q783_01590        CDS       T02884                                 

Definition
(GenBank) carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
caw  Carnobacterium inhibens
Brite
Enzymes [BR:caw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Q783_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 DLH Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 BAAT_C DUF2048 DUF2555 PGAP1
Motif
Other DBs
NCBI-ProteinID: AGY81051
UniProt: U5S7L1
Position
330010..330762
Genome map
AA seq 250 aa AA seqDB search
MAIHSFFFEKGPQAVILMHAYSSTPNDVRMLARALEKENYTVYAPLFKGHGTDDPEDILA
ASPKDWVRDAKEAIHFLKEKGYQEIAVFGLSLGGIIATKMLVDSEPIVAGGTFCSPVVNF
HSENNVKEAFLTLVRIMKKKAGYSELEINDRMPEVERKLTNQLTELNELTKSMGNQYSEI
KKPVFIAQAGQDEMINPELSIAFKESLKQAPVVDFHWYEDSKHAVTVGVDRKALQTDVSS
FLKQLDWNGG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacactcatttttttttgaaaagggtcctcaagcagtaatcttgatgcatgcg
tattccagcacacccaatgatgtacgaatgttggcaagagccttagagaaggaaaattat
acggtctatgcgcctttatttaaagggcacggaacagatgatcccgaagatattttagca
gcatctccaaaagattgggtaagagatgcaaaagaagctatccacttcctaaaagaaaaa
gggtatcaagaaatagccgtttttgggttatctttaggcggcataatcgcaacaaaaatg
ctggttgatagtgaaccgatagtggcaggtggaacattttgttcaccagttgtaaacttt
cacagtgaaaataatgttaaagaagcatttttaacattagtacgaataatgaaaaagaaa
gcaggttattcggaactagagataaatgaccgaatgccagaagtagaacgtaaattaaca
aatcaattaactgaattaaacgaattaaccaaatcaatgggaaatcagtacagtgagata
aagaaaccagtttttatcgcgcaagctggtcaagacgaaatgatcaacccggagctttct
atagcttttaaagagtcattgaaacaagctcctgtggtagattttcattggtatgaagac
agtaaacatgctgtaaccgtgggtgtagatcgtaaagcgttgcaaacagatgtcagcagc
tttttaaaacagttagattggaatggaggataa

DBGET integrated database retrieval system