KEGG   Carnobacterium inhibens: Q783_06215Help
Entry
Q783_06215        CDS       T02884                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
caw  Carnobacterium inhibens
Pathway
caw00071  Fatty acid degradation
caw00072  Synthesis and degradation of ketone bodies
caw00280  Valine, leucine and isoleucine degradation
caw00310  Lysine degradation
caw00362  Benzoate degradation
caw00380  Tryptophan metabolism
caw00620  Pyruvate metabolism
caw00630  Glyoxylate and dicarboxylate metabolism
caw00640  Propanoate metabolism
caw00650  Butanoate metabolism
caw00900  Terpenoid backbone biosynthesis
caw01100  Metabolic pathways
caw01110  Biosynthesis of secondary metabolites
caw01120  Microbial metabolism in diverse environments
caw01130  Biosynthesis of antibiotics
caw01200  Carbon metabolism
caw01212  Fatty acid metabolism
caw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q783_06215
   00630 Glyoxylate and dicarboxylate metabolism
    Q783_06215
   00640 Propanoate metabolism
    Q783_06215
   00650 Butanoate metabolism
    Q783_06215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q783_06215
   00072 Synthesis and degradation of ketone bodies
    Q783_06215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q783_06215
   00310 Lysine degradation
    Q783_06215
   00380 Tryptophan metabolism
    Q783_06215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q783_06215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q783_06215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q783_06215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caw04147]
    Q783_06215
Enzymes [BR:caw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q783_06215
Exosome [BR:caw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q783_06215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGY81855
UniProt: U5S9D3
Position
complement(1280261..1281517)
Genome map
AA seq 418 aa AA seqDB search
MPRMRMDDPIVIVGAARTPIGTYLGGLKTVPAGELGAIALNEAIKRAGIKSEEIEEVIAG
QAMGTQEESNIGRVIGLKAGLKKQSTGMTVNRICGSGIQSAISATQELMTMDVDFIAAGG
VESLSRSEYYLPLESRWEGFKAGNFTVIDANLALHKHAQPNPDYPEITHMGDTAEKVAER
YAITREEQDTFAVDSQRKASSAIESGRLAQEIVPVEVIGRKGVVTVVDKDEHPRPGTNME
SLARLKPAFRKDGKGTITAGNASGLNDGAAFEVFTKASVAKERGLDVMAKIVDFAIAGCD
PNVMGLGPVYAINKVLSQNKLTLEDIDILEINEAFAAQTLGCMKELGIDPGTELYERLNP
NGGAIALGHPLGMSGARIITSLCYEFKNHPEKKYAIASACIGGGQGIALLLENGSVNE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaatgagaatggatgatccaattgtaattgttggggcagcacgcacaccaatt
gggacttacttaggaggattaaaaacagttcctgctggagagttaggtgctattgcgtta
aatgaagccattaaacgggctggtataaagagtgaagaaatagaagaagtgatagccggt
caagcaatgggtacacaggaagaaagtaatatcgggcgtgtcattggattgaaagctgga
ttaaagaagcaatcgactgggatgactgtcaatcgtatctgtggttctggtatccagtcg
gctatttcagcaacacaagaattgatgacaatggacgttgattttattgcagctggagga
gtagaaagtctttctcgttcggagtactatttaccattagaatcaagatgggaagggttt
aaagcaggtaacttcactgttattgatgcaaacttagcacttcataaacatgctcaaccg
aatccggattatcctgagattactcacatgggggatacagcagaaaaagttgcagaaaga
tatgcgatcactcgtgaagaacaagatacatttgcagttgatagtcaacgaaaggcctct
tctgctatagaaagcggtcggcttgctcaagaaatcgttccagtagaagtgatcggtcga
aaaggcgttgtaacagtagtcgataaagatgaacatcctagacccggcacgaatatggaa
agtttagcacgtttaaaacctgcctttcgtaaagatggtaaagggacgattactgctgga
aatgcatccggactaaatgatggagcagcttttgaggtatttacgaaagcatctgttgct
aaagaacgaggacttgatgtaatggctaaaatcgttgattttgctatagctggttgtgat
cctaatgtaatgggtttaggaccggtttatgcaatcaataaggttttaagtcaaaacaaa
ctaactcttgaagacattgatattttagaaatcaatgaagcatttgcggctcaaacatta
ggatgtatgaaagaattaggtatcgatcctggaactgagctatacgaacgattgaatcca
aatggtggagcgattgcattgggtcatccattaggaatgtcaggtgcgcgtatcattact
tcactttgttatgaatttaagaaccaccctgaaaaaaaatatgccattgcatcagcatgc
attggcggcggtcaaggaattgcattactattagagaatggatctgttaatgaatga

DBGET integrated database retrieval system