KEGG   Corynebacterium atypicum: CATYP_00385Help
Entry
CATYP_00385       CDS       T03227                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cax  Corynebacterium atypicum
Pathway
cax00071  Fatty acid degradation
cax00280  Valine, leucine and isoleucine degradation
cax00310  Lysine degradation
cax00380  Tryptophan metabolism
cax00620  Pyruvate metabolism
cax00630  Glyoxylate and dicarboxylate metabolism
cax00640  Propanoate metabolism
cax00650  Butanoate metabolism
cax00900  Terpenoid backbone biosynthesis
cax01100  Metabolic pathways
cax01110  Biosynthesis of secondary metabolites
cax01120  Microbial metabolism in diverse environments
cax01130  Biosynthesis of antibiotics
cax01200  Carbon metabolism
cax01212  Fatty acid metabolism
cax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CATYP_00385
   00630 Glyoxylate and dicarboxylate metabolism
    CATYP_00385
   00640 Propanoate metabolism
    CATYP_00385
   00650 Butanoate metabolism
    CATYP_00385
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CATYP_00385
   00072 Synthesis and degradation of ketone bodies
    CATYP_00385
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CATYP_00385
   00310 Lysine degradation
    CATYP_00385
   00380 Tryptophan metabolism
    CATYP_00385
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CATYP_00385
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CATYP_00385
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CATYP_00385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cax04147]
    CATYP_00385
Enzymes [BR:cax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CATYP_00385
Exosome [BR:cax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CATYP_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIG63415
UniProt: A0A075TTH0
Position
87106..88377
Genome map
AA seq 423 aa AA seqDB search
MLGGNRIPFARSNKEYADASNRDMLTAAIDGLVARYGLQDERLGMVAAGAVLKHVRDFNL
TRECVLGSSLASTTPAIDVQQACGTGLAAAVYVSDAIARGRIDVGLAGGVDTTSDAPLAV
GDQLRRTLIKLTRAKSASQRAKLIGSIRPAQFVPEQPQNGEPRTGLSMGEHAAITAREFG
ITRQERDELAARSHQNLARAYGEGFFSDLITPFLGVQRDTNLRPDSTVEKLAALRPVFGK
KDAELHGAQATMTAGNSTPLTDGASVALLASEKWAEEHRLPVRAWLVDTETAAVDFVHGP
DGLLMAPTYAIPRLLDRNGLTLQDFDFYEIHEAFASQVLAALAAFESAEYCRDRLGLTEA
LGAIDRERLNVKGSSLAAGHPFAATGARILATAAKMLEEAGGGRTLVSICAAGGQGIAAI
VER
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atcctgggcggcaaccggatcccgtttgcccggtcgaataaggagtacgcggatgcctcg
aaccgggacatgctcaccgcggccatcgacgggctggtcgcccgctacggcctgcaggac
gagcggctgggcatggtcgccgccggcgccgtgctcaagcacgtgcgggactttaacctc
acccgcgagtgtgtgctcggcagctcattagcgtcgacgactccggcgatcgacgtgcaa
caggcttgcggcactgggctggccgcggcggtgtatgtcagcgacgcgatcgcccggggt
cgcatcgatgttgggctcgcaggcggggtggatacgacgtcggacgcgcccctggccgtt
ggcgatcagctgcgccgcacgctgattaagctaacccgggccaagtccgccagccagcgt
gccaagctgattggctcgatcaggccagcccagttcgtgcccgagcagccacagaatggc
gagccgcgcaccgggttgtcgatgggggagcatgcggcgattaccgcgcgggagtttggc
atcacccgccaggagcgggatgagctagccgcgcgttcgcatcagaacctggcccgagcg
tacggggaaggcttttttagcgatctgatcacgccgtttttgggcgtgcagcgcgatacc
aatctgcgtccggattccaccgtggagaagttggcggcgctgcgtccggtatttggtaag
aaggacgctgagctgcacggagcgcaggccacgatgacggccgggaattcgacgccgctt
actgacggcgcgtcggtggcgctgttggcttcggaaaagtgggccgaggagcatcgtctg
ccggtgcgtgcgtggctggttgacaccgagacggcggccgtggactttgtgcatggtccc
gacgggttgctcatggcgcctacctacgcgatcccgcggttgttggatcgcaacgggctt
acgctgcaggacttcgacttctatgagattcacgaggcctttgcctctcaggtgctggcc
gctctcgcggcgtttgagtctgcggagtattgccgggatcggttgggcctaacggaggcg
ttgggtgctatcgatcgcgagcgcctgaatgtcaagggttcctcgttggcggctgggcac
ccgttcgccgcgacgggtgcccgcatcctggctaccgcggcgaagatgctggaagaggcc
ggtggtggtcgcactttggtgagtatttgcgcggccggcgggcagggcatcgcggccatt
gtggagcggtag

DBGET integrated database retrieval system