KEGG   Corynebacterium atypicum: CATYP_03405Help
Entry
CATYP_03405       CDS       T03227                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cax  Corynebacterium atypicum
Pathway
cax00450  Selenocompound metabolism
cax00970  Aminoacyl-tRNA biosynthesis
cax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CATYP_03405
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CATYP_03405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cax01007]
    CATYP_03405
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cax03016]
    CATYP_03405
Enzymes [BR:cax01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CATYP_03405
Amino acid related enzymes [BR:cax01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CATYP_03405
Transfer RNA biogenesis [BR:cax03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CATYP_03405
 Prokaryotic type
   Other AARSs
    CATYP_03405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AIG63873
UniProt: A0A075TV32
Position
719143..720975
Genome map
AA seq 610 aa AA seqDB search
MSHRVLVSVAWPYANGPRHIGHVAGFGVPSDVFARYQRMSGADVLMISGTDEHGTPLLVQ
ADKEGVSVTELADRYNRQICEDLAGLGLSYDLFTRTSTRNHYAVVQELFRGLYRNGYMVK
QTTMGAVSPTTGRTLPDRYIEGECPICGADGARGDQCDNCGNQLDPVDLINPRSKINGEA
PKFVETEHFLLDLPALAGALASWLKTRDSWRPNVLKFSMNLLADVHPRAMTRDIDWGIPV
PVEDWQDNPAKKLYVWFDAVIGYLSASLEWAWRSGDPEAWKKWWQDPQAQSYYFMGKDNI
TFHSQIWPAELIGYAGEGEHGGQPGKYGKLNLPTEVVSSEFLTMSGSKFSSSKGVVIYVK
DFLKEFGPDPLRFYIAVAGPENNDADFTWEEFVRRINFELANGWGNLVNRTVSMAYKNFG
EVPAPGTLEPADEALLTLAADTFEEAGRLLGASKFKAAITQIMHAVGEANAYIAAQEPWR
LAKDDAQRERLASVLWTALQVVSDLNVMLTPFIPHIAQRVHETLGRSGVWAAQPRIEEVR
DDIPVELVGVNLPEEGKSYPVITGDYAAEQARWERIEMVPGTALAKPKPLIKKLDPELGQ
TGPEWAPVAS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacagagtgcttgtctcggttgcttggccgtacgccaacggccctcgccacatt
ggccacgttgctggtttcggcgtcccctcggacgtgtttgcccgctaccagcgaatgtcg
ggggcggacgtgctcatgatctccggtaccgacgagcacggcaccccgctactcgtgcag
gcggataaagagggcgtttcggtgaccgagctagcagaccggtacaaccggcagatctgc
gaggatctcgcaggtttggggctctcgtacgatctgttcacccgcaccagcacccgcaac
cactacgcggtggtccaggagctctttcgaggtctctaccgcaacggttatatggtcaag
cagaccacgatgggggcggtgtctccgacgacgggccggacgctgccggaccggtacatc
gagggcgaatgcccgatctgcggggccgacggagcccgtggggaccagtgcgataactgc
ggcaaccagctcgaccccgtcgacctgattaacccgcgcagcaagatcaacggcgaggcc
cccaagtttgtcgagaccgagcacttcctgctcgatctgccggcccttgcaggcgccttg
gcctcctggctgaagacgcgggattcctggcgcccgaacgtgctcaagttctcgatgaac
ctcctggcggatgtgcacccgcgcgcgatgacgcgggacatcgactggggcatcccggtg
ccggtggaagactggcaggacaaccccgccaagaagctctacgtgtggttcgacgcggtg
atcgggtacttgtctgcctcgctggaatgggcgtggcgttcgggagacccggaggcgtgg
aaaaagtggtggcaggatccgcaggcgcagagctactacttcatgggcaaggacaacatc
accttccattcccagatctggccggccgagctcatcggctatgccggagagggggagcat
gggggtcaacccgggaagtacggcaagctcaacttgcccactgaggtggtctcgtccgag
tttctcaccatgtccggatcgaagttctcttcgtcgaagggtgtcgtgatctacgtcaag
gacttcctcaaggagttcggcccggatccgttgcgcttctacatcgctgtggccggcccg
gagaacaacgacgcggacttcacctgggaggagtttgtgcgccggattaacttcgagctc
gccaacggctggggcaacctggtcaaccggaccgtatcgatggcctacaagaacttcggc
gaggtccccgcgccgggcaccttggagccggccgacgaggcgttgttgacgctggccgcc
gacacgttcgaggaagcggggcgcctgctcggcgcatcgaagtttaaggccgcgatcacc
cagatcatgcacgccgtcggcgaggccaacgcctacatcgccgcccaggagccgtggcgg
ttggccaaggacgacgcgcagcgcgagcgcttggcatctgtgctctggaccgcgctgcag
gtggtcagcgacctcaacgtgatgctcaccccgtttatcccgcacatcgcccagcgggtc
catgagaccctggggcgcagtggggtgtgggccgcacagccgcgaatcgaggaagtccgc
gacgatatcccggtggagcttgttggggtcaacctgccggaagaaggcaagtcttacccg
gtgatcacgggtgattacgccgccgagcaggcccgctgggagcgcatcgagatggtcccg
ggcaccgcgttggccaagccgaagccgttgatcaagaagctcgatcccgagctcggccag
actggccccgagtgggcgcccgtggcttcgtga

DBGET integrated database retrieval system