KEGG   Corynebacterium atypicum: CATYP_07235Help
Entry
CATYP_07235       CDS       T03227                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cax  Corynebacterium atypicum
Brite
KEGG Orthology (KO) [BR:cax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cax03009]
    CATYP_07235
Enzymes [BR:cax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CATYP_07235
Ribosome biogenesis [BR:cax03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CATYP_07235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AIG64414
UniProt: A0A075TSB0
Position
complement(1586966..1587892)
Genome map
AA seq 308 aa AA seqDB search
MREVRSLPVPEGLAGMRADAAVSRLFGVSRAVAADLAAAGDVLVAGAPVTKSTRFKEGDW
LEVTLPEPPEPLAAEPAAEVAGMDILYSDADVIAVNKPVGVAAHPTVGWEGPTVTAGLKA
AGFRISTSGPLERKGIVQRLDVGTSGVMIVAASERGYSKLKRAFRERTVKKTYHALVQGH
PDPFSGTIDAPIARHPKHGWRFAVVQGGKPAVTHYRTLEAFPEATLLEVHLETGRTHQIR
VHMSSLRHPCVGDPMYGGDPVLAERLGLNHQWLHAVCLGFEHPASGKWTQIRAPYPADLE
HALEVIRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggttcgatcgttgccggtgccggaggggttggctgggatgcgcgctgacgcc
gcggtatcgcggctttttggggtgtcgcgcgcggtggctgcggatttggcggcggccggc
gacgtcttggtggccggcgctccggtgacaaagtcgacgcggtttaaagaaggcgactgg
ttggaggtgactctgccggaaccgccggagccgttggccgcggagccggccgctgaggtt
gccgggatggatattctttattcggacgccgatgtgatcgcggtgaataagccggttggg
gtggcagctcatccgacggtgggctgggagggtccgacggttacggcggggctcaaggcg
gcggggtttcgtatttctacttcgggccccctggagcggaaggggatagtgcagcggtta
gacgtgggtacgtccggggtgatgatcgtcgctgctagtgagcgtgggtattctaagctg
aagcgggcgtttcgcgagcgcacggtgaaaaagacttatcacgcgctcgtgcaggggcac
ccggacccgttttcggggactatcgacgccccgatagcccgccaccctaagcacggctgg
cggttcgcggtggtccaggggggcaagccggccgtgacgcactatcgaacgctggaggcg
ttcccagaggcgacgcttctcgaggtgcacctagagacggggcgtacccaccagatccgt
gtgcacatgtcttcgctgcgccatccgtgcgtgggcgacccgatgtacggcggcgacccg
gtgttagccgagcggttggggctgaaccatcagtggttgcacgcggtgtgtttgggtttc
gagcacccggcttcgggcaagtggacgcagatccgggctccgtacccggcggaccttgag
cacgcgctcgaggtgattcgccggtga

DBGET integrated database retrieval system