KEGG   Clostridium acetobutylicum EA 2018: CEA_G0031Help
Entry
CEA_G0031         CDS       T01864                                 

Gene name
psdD
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00564  Glycerophospholipid metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
Module
cay_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cay00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CEA_G0031 (psdD)
Enzymes [BR:cay01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CEA_G0031 (psdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADZ19074
Position
complement(41890..42774)
Genome map
AA seq 294 aa AA seqDB search
MIKYYNRKTKQYEIEKVAGENYLNWTYSSPIGMSFLEALIKKKAFSSIYGSFCDSKISKG
KVKKFIDSFDIDILESEKKPEAFKSFNDFFTRKLTKEARPFSTNKEILISPGDGRLLVYE
NIDLDNLVEIKGMGYSLKELIKDEKISSKYKNGICMILRLCPTDYHRFHFVDSGVCSATS
KIKGSYYSVNPIALNKVKRLFCENKREWSILKSDNFKDILYIEVGATCVGSIIQTYKENT
KVNKGDEKGYFKFGGSTVVLFFEKDSVKIDEDILEQTRLGYETKVFMGESIGKK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatattataatagaaaaacaaagcagtatgaaattgagaaggtagcaggggaa
aattaccttaactggacttactcctctcctattggaatgagctttctggaagctttgata
aagaagaaggcattttcaagtatatatggttcattttgtgattcaaaaatcagtaaaggc
aaagtaaaaaaattcatagactcctttgatattgacattctagaaagtgaaaaaaagcct
gaagctttcaaatccttcaatgatttctttactagaaaacttacaaaagaagcaagacct
ttctccacaaataaagaaattttaatttctcctggagatggtagactacttgtttatgag
aatatagatttagataatttagttgaaataaaaggtatgggctatagcctaaaggaactt
ataaaggatgaaaaaataagctcaaaatataagaatggaatatgtatgattctaaggcta
tgtccaactgattatcataggtttcattttgtagatagcggtgtgtgcagcgctacctca
aaaattaaaggctcatattactcagtgaatcctattgccttaaataaagtaaagaggtta
ttttgcgaaaacaaaagagaatggagtatattaaagtctgataattttaaggatatccta
tatatagaagttggagctacttgcgttggaagtattattcaaacttacaaggaaaatacc
aaggtcaacaaaggtgatgaaaaaggctactttaaatttggaggctccacagtagtttta
ttctttgaaaaagattcagttaaaatagatgaagatatacttgagcaaacaagattaggt
tacgaaactaaagtatttatgggtgaaagtattggaaaaaaataa

DBGET integrated database retrieval system