KEGG   Clostridium acetobutylicum EA 2018: CEA_G0263Help
Entry
CEA_G0263         CDS       T01864                                 

Gene name
nifK
Definition
(GenBank) Nitrogenase molybdenum-iron protein, beta chain, gene nifK
  KO
K02591  nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00625  Chloroalkane and chloroalkene degradation
cay00910  Nitrogen metabolism
cay01100  Metabolic pathways
cay01120  Microbial metabolism in diverse environments
Module
cay_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:cay00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CEA_G0263 (nifK)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEA_G0263 (nifK)
Enzymes [BR:cay01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     CEA_G0263 (nifK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADZ19304
Position
287176..288540
Genome map
AA seq 454 aa AA seqDB search
MLDETPKEIYERKALRINPARTCQPIGAMYAALGIHNCLPHSHGSQGCCSYHRMQLTRHF
KDPIMASTSSFNEGASVFGGRANFNTAIKNIFSIYNPDIVAVHTTCLSETLGDDLVSYIA
DSEVPEGKIVIHANTPSYVGSHITGFSSMVKAMVTYLSENTKNKNGKVNVLPGFVGPADM
RELKKIFKCMKVPFIMMPDTSGVVDSPMTGEYKMYPKGGTTIDELRDAGNSDYTFALGSL
ASEAAAIELEKKCKVPFSVLNTPIGIDATDRFIMELSKITGKKVPYEIEEERGQLVDLML
DSYQYFHGKKVAISGDPDTVIALTEFVISLGMNPKYVITGTKGEKFEKTINKMLEDNGIE
GSKVKSFSDLFELHQWIKNEPVDLVIGNSHMKFIARAEDIPLVRFGFPVMDRYGHSYIPK
VGYKGAMNLLTSMCDAILERMDRDSAEEDYELVR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgaaacacctaaggagatatatgaaagaaaagctttaagaataaatccagcc
agaacatgtcagccaataggagccatgtatgcagcactcggcatacataactgcctacca
cacagtcatggttctcagggttgttgctcataccatagaatgcaattaacaagacatttc
aaagatcctatcatggcatctaccagttcttttaatgaaggagctagtgtttttggagga
agagctaacttcaatacggcaataaaaaatatattttcaatatacaatcctgatattgta
gcagttcacacaacatgcctttcagaaactctcggcgatgacctagtgagttatattgct
gattcagaagttccagaaggaaaaatagtaatccatgcaaatactccaagctatgttgga
tcacatataactggattttccagtatggttaaggctatggtaacttatctttccgaaaat
acaaaaaacaaaaatggaaaagtaaatgttctgccaggctttgtgggccctgcggatatg
agagaattaaagaaaatatttaagtgtatgaaggttccatttataatgatgccagatact
agtggtgtagtggattcgcctatgactggcgagtataagatgtatcctaagggtggaact
acaattgatgaattaagagatgccggtaattcagattatacatttgctttaggaagttta
gcgtcagaagcggcagctatagaactagagaagaaatgtaaagtgccttttagcgtgtta
aatacacctataggaatagatgctactgatagatttataatggaattgtctaaaataaca
ggcaagaaagtaccttatgaaatagaagaggaaagaggacaacttgttgatttgatgctt
gatagttatcaatattttcatggtaaaaaggttgcaatttcaggggatccggatacagtt
atagcattaactgaatttgttatttcactgggtatgaatcctaagtatgttataacaggt
acaaaaggagaaaaatttgaaaagacaataaataaaatgttggaggataacggaattgaa
ggttcgaaagtgaagagcttctcagatttatttgaacttcatcaatggataaaaaatgaa
cctgtagatttagttataggtaattcacatatgaaatttatagctagggcagaagatatt
ccattagttagatttggatttcccgtaatggatagatacggacattcttatattcctaag
gttggctacaaaggggcaatgaatctgcttacaagtatgtgtgacgctatacttgaaaga
atggacagagacagtgctgaggaagattatgaattagttagataa

DBGET integrated database retrieval system