KEGG   Clostridium acetobutylicum EA 2018: CEA_G1066Help
Entry
CEA_G1066         CDS       T01864                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00220  Arginine biosynthesis
cay00330  Arginine and proline metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01130  Biosynthesis of antibiotics
cay01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CEA_G1066
   00330 Arginine and proline metabolism
    CEA_G1066
Enzymes [BR:cay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CEA_G1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADZ20105
Position
complement(1207313..1208212)
Genome map
AA seq 299 aa AA seqDB search
MNIDILGVPIYYGSDRKGVDLGPSKLREKNLASLIAKYNHNVKDMGDVNVPFISEKDKFK
FNDKMKFLKPIVEANTELANKVYESLSSGNFPFVVGGDHSLGLGSITGASKALDNLAVIW
IDAHTDINTDKTTETGNVHGMPLSAAMGIGASELTNICYNGQKVKPENVFIIGARSIDKG
ELALIYEKNLTFYSTKTVKRLGVEYILKEITEKLSKNNINSVHLSFDIDCLDETIVPGTG
TPVSDGLNVDDTKLMVESLVKSGLVKSMDLVEFNPALDKDHQTEDLVMEFIDCIFKNLK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgatatattaggcgtacctatctactatggttctgatagaaaaggagtagat
ttaggtcccagcaagttgagagaaaaaaatttagcgtcacttatagccaagtacaatcac
aatgttaaagatatgggcgatgttaatgtaccatttatatccgaaaaggataaatttaaa
ttcaatgataaaatgaaatttttaaagcccatagttgaagcgaatacagaactcgcaaac
aaggtttatgaatcactatcctccggaaactttccatttgtagtaggaggtgaccattca
ctcggtcttggcagcataacgggtgcaagtaaagctcttgataaccttgcagtaatatgg
attgacgctcacacagatataaacacagacaaaaccacagaaacaggtaatgttcacgga
atgcctttatctgctgcaatgggtattggtgcaagcgaacttacaaacatatgctataac
ggtcaaaaagtgaaaccagaaaatgtgttcataataggagcaagatcaattgataagggt
gaattagctctaatttatgaaaaaaaccttaccttctattcaacaaaaaccgtaaagaga
ttaggtgttgagtatattctcaaagagattaccgaaaagctttcaaaaaataatatcaat
tcagttcatctaagttttgatatagattgtcttgatgaaaccatagtaccaggaacagga
acaccggtttctgatggtctaaatgtagacgatactaaactaatggtagaatctcttgtt
aaaagcggtcttgttaagtccatggatcttgttgaatttaatccagctttggataaagat
catcaaactgaagatttagttatggagtttattgactgtatttttaaaaacttaaagtag

DBGET integrated database retrieval system