KEGG   Clostridium acetobutylicum EA 2018: CEA_G2732Help
Entry
CEA_G2732         CDS       T01864                                 

Definition
(GenBank) dipeptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00300  Lysine biosynthesis
cay01100  Metabolic pathways
cay01120  Microbial metabolism in diverse environments
cay01230  Biosynthesis of amino acids
Module
cay_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CEA_G2732
Enzymes [BR:cay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CEA_G2732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADZ21769
Position
complement(2847572..2848969)
Genome map
AA seq 465 aa AA seqDB search
MDKINEKIDLLKDDMVSSIQEILRIKSISGEAEGNAPFGKDTAKALDYALKLAERLGFKT
VNLDNYVGYAEYGEGEDYVAVLGHLDVVPEGDGWNYPPYAAEIHDGKLYARGSMDDKGPT
VACLYSLKAIVDAGLTMSKKVRIIFGLDEETGSGKDTEHYLKNEKPPVLGFTPDAEYPII
NGEKGITIFNLVKDFKNDYEGDTKIIYVKGGERSNVVPPYAEAGIRADLKGEIIDKCESF
AERTGYDIKAEEKDDMVIVKSKGIAAHGSMPELGKNAIMQLLAFLEELNLGKSDFNDYIA
FLNRYVGMETNGESFGIGMEDKVSGKLSFNLGIIDFNKDQGKVVLNVRYPVTCKYEDMMD
GINARIADTGIRVENMTHQKSLYFPEDHELVKLLQKVYKEQTSEEPKLLSIGGGTYAKEM
PNIVAFGPIFPGEPDVDHQANEFIKIEHLILNAKIYAHAIYELAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggataagataaacgagaagatagacttattaaaggatgatatggtttcttcaattcaa
gaaatccttagaattaaaagtatcagcggggaagctgaaggaaatgcaccatttggaaag
gatacagcaaaggcacttgactatgctttaaagttagctgaaagacttggtttcaaaact
gttaatttagataactatgttggatatgctgaatatggtgaaggagaagattatgtagca
gtacttggtcaccttgatgtagtgccagaaggagatggatggaattatcctccatatgct
gcagaaatacatgatggaaagctatatgcaagaggatcaatggatgacaagggacctaca
gtagcatgtttatattcattaaaggctattgtggatgcaggacttactatgtctaaaaaa
gttagaattatattcggtttggatgaggaaactggttcaggaaaagatacagagcattat
ttaaagaatgaaaaaccaccagttcttggctttactccagatgctgaatatccaataatc
aatggagaaaaaggaataacaatttttaacttagtaaaagattttaaaaatgattacgaa
ggagatacaaagattatttatgtaaaaggaggagaaagatcaaatgtagttcctccatac
gctgaagctggaataagagcagatttaaagggcgaaatcattgataaatgtgaaagtttc
gctgaaagaactggatatgatataaaagctgaagaaaaagacgatatggttatagtaaaa
tcaaaaggaattgctgcacatggaagtatgccggagcttggaaaaaatgctataatgcag
cttttagcttttctagaagaattaaatcttggaaaatctgattttaatgattatatagct
ttcttaaatagatatgttggaatggaaactaacggagaatcttttggaattggtatggaa
gataaggtttcgggtaagctttccttcaatcttggaataatagactttaataaagaccaa
ggaaaagttgttcttaatgttagatatcctgtaacttgcaaatacgaggatatgatggat
ggaataaatgctaggatagctgatactggaataagagttgaaaacatgacacaccagaag
tcattatactttccagaagatcatgaattagtaaaacttcttcaaaaagtatataaagag
caaactagtgaggagccaaaacttctttcaataggcggaggaacttatgcaaaggaaatg
cctaacatagtagcctttggaccaatattcccaggagaaccagatgttgatcaccaagca
aatgaatttataaaaattgaacatttaatactaaatgcaaaaatatatgctcatgcaata
tatgagcttgctcgttaa

DBGET integrated database retrieval system