KEGG   Clostridium acetobutylicum EA 2018: CEA_G2880Help
Entry
CEA_G2880         CDS       T01864                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00071  Fatty acid degradation
cay00072  Synthesis and degradation of ketone bodies
cay00280  Valine, leucine and isoleucine degradation
cay00310  Lysine degradation
cay00362  Benzoate degradation
cay00620  Pyruvate metabolism
cay00630  Glyoxylate and dicarboxylate metabolism
cay00640  Propanoate metabolism
cay00650  Butanoate metabolism
cay00900  Terpenoid backbone biosynthesis
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
cay01120  Microbial metabolism in diverse environments
cay01130  Biosynthesis of antibiotics
cay01200  Carbon metabolism
cay01212  Fatty acid metabolism
cay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CEA_G2880
   00630 Glyoxylate and dicarboxylate metabolism
    CEA_G2880
   00640 Propanoate metabolism
    CEA_G2880
   00650 Butanoate metabolism
    CEA_G2880
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEA_G2880
   00072 Synthesis and degradation of ketone bodies
    CEA_G2880
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEA_G2880
   00310 Lysine degradation
    CEA_G2880
   00380 Tryptophan metabolism
    CEA_G2880
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CEA_G2880
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CEA_G2880
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CEA_G2880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cay04147]
    CEA_G2880
Enzymes [BR:cay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CEA_G2880
Exosome [BR:cay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEA_G2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADZ21917
Structure
PDB: 

Position
complement(3005220..3006398)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAG
LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR
APYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFAL
ASQKKAEEAIKSGQFKDEIVPVVIKGRKGETVVDTDEHPRFGSTIEGLAKLKPAFKKDGT
VTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAAI
EKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILVT
LVHAMQKRDAKKGLATLCIGGGQGTAILLEKC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttgtaatagctagtgcagtaagaacagcgattggatcttatggaaagtct
cttaaggatgtaccagcagtagatttaggagctacagctataaaggaagcagttaaaaaa
gcaggaataaaaccagaggatgttaatgaagtcattttaggaaatgttcttcaagcaggt
ttaggacagaatccagcaagacaggcatcttttaaagcaggattaccagttgaaattcca
gctatgactattaataaggtttgtggttcaggacttagaacagttagcttagcagcacaa
attataaaagcaggagatgctgacgtaataatagcaggtggtatggaaaatatgtctaga
gctccttacttagcgaataacgctagatggggatatagaatgggaaacgctaaatttgtt
gatgaaatgatcactgacggattgtgggatgcatttaatgattaccacatgggaataaca
gcagaaaacatagctgagagatggaacatttcaagagaagaacaagatgagtttgctctt
gcatcacaaaaaaaagctgaagaagctataaaatcaggtcaatttaaagatgaaatagtt
cctgtagtaattaaaggcagaaagggagaaactgtagttgatacagatgagcaccctaga
tttggatcaactatagaaggacttgcaaaattaaaacctgccttcaaaaaagatggaaca
gttacagctggtaatgcatcaggattaaatgactgtgcagcagtacttgtaatcatgagt
gcagaaaaagctaaagagcttggagtaaaaccacttgctaagatagtttcttatggttca
gcaggagttgacccagcaataatgggatatggacctttctatgcaacaaaagcagctatt
gaaaaagcaggttggacagttgatgaattagatttaatagaatcaaatgaagcttttgca
gctcaaagtttagcagtagcaaaagatttaaaatttgatatgaataaagtaaatgtaaat
ggaggagctattgcccttggtcatccaattggagcatcaggtgcaagaatactcgttact
cttgtacacgcaatgcaaaaaagagatgcaaaaaaaggcttagcaactttatgtataggt
ggcggacaaggaacagcaatattgctagaaaagtgctag

DBGET integrated database retrieval system