KEGG   Clostridium acetobutylicum EA 2018: CEA_G2987Help
Entry
CEA_G2987         CDS       T01864                                 

Definition
(GenBank) Mannose-1-phosphate guanyltransferase (pyrophosphorylase domain and phosphomannomutase domain)
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
cay00051  Fructose and mannose metabolism
cay00520  Amino sugar and nucleotide sugar metabolism
cay01100  Metabolic pathways
cay01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CEA_G2987
   00520 Amino sugar and nucleotide sugar metabolism
    CEA_G2987
Enzymes [BR:cay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CEA_G2987
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     CEA_G2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_I Hexapep NTP_transf_3 PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADZ22024
Position
complement(3115642..3118089)
Genome map
AA seq 815 aa AA seqDB search
MKAIIMAGGQGKRLRPLTCNLPKPMMPIMQKPVLQYIIELLKKHGINEIGITLHYLPDEV
MDYFGDGKELGVNIHYFIEQSPLGTAGSVRNAESFLDETFVVISGDALTDVNLTNILQYH
KEKNAMVTIVLKKVTIPLEYGVAITDTEGRISNFIEKPGWGEIFSDKANTGIYVMEPGIF
EFYNKDKKFDFSEELFPELLKSGKEIFGYVVNDYWRDIGNIEQFMKCNFDILNGYVDVDV
DIDASQHQKGVWIGKNTIVSDNVKVIPPVYIGDNSEIRYGAEIGPFAVIGRNNIISEMAT
IKRSIIFENCYIGSGAELRGSVVSNNVQVGGGVSTFEESAIGTGSLVGEKSVVKAGVKIW
PDKVIGSKTIIKTNVVWGENRCKVLFGKEGISGEINVELTPEFVSKLASAFASNLRMNSK
VVVCSDYNLAAEMLKYSFVSGLISMGIEVYSAKEMTIPMLRFSTAYFKADAAVYIYCKGS
NKEKVNILFIDKDGIMISRSMEKKIANSFLREDFRRTRANNFKRLRDFGECMGYYEDYIK
ENLCIQEIRNSGLKVAVSMENKLIKNEVKSIFSDLKIQYSIYDNYADLEGLKKEVIEKKM
DFGVCISENCDKAIIIDENANIISTQMYESIKALILISVYKFKTIVAPVNSSKALKYIAK
RYNCKYVKSKISERYILNEYILNEKDKNIKEVLFSYLSSTDALNIVINIINILARGKIKL
SELMERIPNYILREKEIACSWDNKGKIMRSLIEENISKSIELIEGIKVNYEDAWVLIIPD
SDEPICKIYAESNDEEKTDKIINEFESEIELFMKN
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattatggcaggaggtcagggtaaaagacttagaccacttacatgcaat
ttacctaaacctatgatgccaattatgcaaaagcctgttttacaatatattatagagctt
ttgaaaaaacatgggataaatgaaatcggtattacactgcattaccttccagatgaagtt
atggattactttggagatggaaaagaacttggagtaaatatacattattttatagagcaa
agtcctttgggaactgctggcagtgttaggaatgctgagagttttcttgatgaaaccttt
gtggttataagcggagatgctttaactgatgtgaatttaactaatatcttacaataccac
aaagaaaaaaacgctatggtaacgattgtgctgaagaaggtaactatacctcttgaatat
ggagttgcaattacggacacagaggggagaataagtaattttattgagaagcctggttgg
ggagaaatatttagtgacaaagcaaatacagggatatatgtaatggagccaggtatattt
gaattctataataaggataaaaagtttgattttagtgaggaattatttcctgaactttta
aagagtggcaaagagatttttggttatgtggttaatgattattggagggatataggaaat
atagagcaatttatgaaatgtaattttgatatattaaatggatatgtagatgtagatgta
gatatagatgctagtcagcatcagaagggtgtatggattggaaaaaatacaatagtaagt
gataatgtaaaagttattccaccagtttatataggagataattctgaaatacgttatggt
gcagagatagggccttttgccgttataggtagaaataatattatatctgaaatggctact
ataaagagaagtataatatttgaaaattgttatataggaagtggtgcagaacttagggga
agcgtagtgtcaaataatgttcaagtgggcgggggagtatcaacttttgaggaatctgcc
attggaacaggaagcttggtaggggagaaaagtgttgtaaaagcaggagttaaaatatgg
ccggacaaagttataggaagtaaaacaataataaagacaaatgttgtgtggggagaaaat
aggtgtaaggtgcttttcggtaaagaaggtataagtggagaaataaatgtagaattaacg
ccagaatttgtatcgaaattagcatctgcatttgcatcaaacttaaggatgaattcaaag
gttgtagtatgttcagattacaatttggcagctgaaatgcttaagtattcttttgtttca
ggtcttatttcaatgggaatagaggtttattctgcaaaagagatgacgataccaatgctt
aggttttctacagcatattttaaagcagatgctgctgtatatatatattgtaaaggtagt
aataaagaaaaagtaaatatattattcatagataaggatggaataatgatatcaaggtct
atggagaaaaaaatagcaaacagctttttaagggaagatttcagaagaactagagcaaat
aactttaaaagattaagagactttggagaatgtatgggttattatgaagattatattaaa
gaaaatttgtgcatacaagaaataagaaatagtgggctgaaggttgcagtatcaatggaa
aataagcttataaaaaatgaagtaaagagtatattttcagatcttaaaattcagtatagt
atatatgataattatgcggatttagaagggttaaaaaaagaagttatagagaaaaaaatg
gattttggtgtttgcatatctgagaattgtgataaagcaataattattgatgaaaacgct
aatataataagtactcaaatgtatgagagtataaaagcactgatactaataagtgtatat
aaatttaaaactatagtggcacctgttaattcttctaaagctttaaagtatatagctaag
agatataattgcaaatatgttaagtcaaaaatttcagaaagatatattttaaatgaatat
atcttgaatgaaaaggataaaaatataaaagaggttttgttttcatatctttctagtaca
gatgctttaaacatagtaataaatataattaacatcttagctagaggtaaaataaagctc
tctgagcttatggaaagaataccaaattatattttaagagaaaaagaaatagcttgttcc
tgggataataagggcaaaattatgagaagcttaatagaagaaaatatatcaaagtcaata
gaacttattgagggaattaaggtaaattatgaagacgcttgggttcttattatacctgac
tcagatgaacccatatgtaagatatatgctgaatctaacgatgaagaaaaaactgataag
attataaatgagtttgaaagcgaaatagaattatttatgaaaaattga

DBGET integrated database retrieval system