KEGG   Corynebacterium argentoratense: CARG_02115Help
Entry
CARG_02115        CDS       T02821                                 

Definition
(GenBank) methylmalonyl-CoA carboxyltransferase
Organism
caz  Corynebacterium argentoratense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3 NQRA RnfC_N PTS_EIIA_1 AstE_AspA GCV_H
Motif
Other DBs
NCBI-GeneID: 16729209
NCBI-ProteinID: AGU14588
UniProt: U3GVT3
Position
426126..426491
Genome map
AA seq 121 aa AA seqDB search
MKLKVTVNGIAYSVDVEVEEETRQLGSIVFGSSPTNTPAAPTTASVQGVSANAIAAPLAG
SVSKVLVAEGDAIEAGQVLLVLEAMKMETEITAPKAGTVGAIHVSEGDAVQGGQGLIEID
D
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaaggtgaccgtcaacggtattgcctactccgtcgacgtcgaggtggaggaa
gagacccgccagctcggttcgattgtgttcggctctagcccgaccaacactcccgcagcc
ccgacgaccgcgtccgtccagggcgtgtctgcaaacgctatcgcagccccccttgcgggc
tccgtatccaaggtgcttgttgcagagggcgacgccattgaggcaggtcaagtcctgctc
gtgctggaagccatgaaaatggaaacggaaattaccgcgccgaaggccggcaccgtcggt
gctatccacgtgtccgagggcgatgcggttcaaggcggacagggcctcattgaaatcgat
gactaa

DBGET integrated database retrieval system