KEGG   Corynebacterium argentoratense: CARG_06665Help
Entry
CARG_06665        CDS       T02821                                 

Definition
(GenBank) hypothetical protein
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
caz  Corynebacterium argentoratense
Pathway
caz00471  D-Glutamine and D-glutamate metabolism
caz00550  Peptidoglycan biosynthesis
caz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CARG_06665
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CARG_06665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:caz01011]
    CARG_06665
Enzymes [BR:caz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CARG_06665
Peptidoglycan biosynthesis and degradation proteins [BR:caz01011]
 Precursor biosynthesis
  Amino acid ligase
   CARG_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M AlaDh_PNT_C Mur_ligase_C 3HCDH_N Pyr_redox WcbI AdoHcyase_NAD NAD_binding_7 XdhC_C Pyr_redox_2 2-Hacid_dh_C NAD_binding_8 Pyr_redox_3 GIDA
Motif
Other DBs
NCBI-GeneID: 16730118
NCBI-ProteinID: AGU15457
UniProt: U3GZN8
Position
complement(1377436..1378812)
Genome map
AA seq 458 aa AA seqDB search
MCEFSAESLGRVVVAGAGVSGAGCARLLARVGADVRVADDNETARFRVQEATEVEAWSTA
QLRESLDSVDLVVTSPGWRPDSAVLVAAAEAGVEVIGDVELAWRLDSAGACGAPRTWLAI
TGTNGKTTTTAMAAAMLSEGGFKAEAVGNIGVSVSDALLAEPRIDVIVAELSSFQLHWSS
TIHPAAGVLLNLADDHIDWHGSFDAYALAKAKLLDSDVAIISRDDAAVVRVAGARDVIAF
GSGIPLDGELGVEDGMLVDRAFGGGVLASAEGISPAGPAGVYDALAAAALARSQGVEPQA
IARALDTFEVSGHRGQVVHEHNGVAFVDNSKATNPHAADAALRGQSGVHWVAGGQLKGAD
VAELVREHAPHMAAAYLMGVDREVIRQALLDARPDLPIVVTDSTDPVAATEELVAAAAAA
AQPGQSVVLAPAAASLDMFTGMGQRGDLFADAARRFAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagttttcggctgagtctctgggccgtgtcgttgttgcgggtgccggtgtgtct
ggcgcggggtgtgcccgtcttcttgcacgcgttggggcggatgttcgggtggccgacgat
aatgagaccgcgcgtttccgcgtgcaggaggctacggaggtcgaagcgtggtcaaccgcg
cagctgcgcgaatccttggattcggttgatttggtggtgacgtcgccggggtggcggccc
gattcggctgttctggtggcggctgctgaggctggcgttgaggtcattggtgacgtcgaa
ttggcgtggcgcctggattccgccggtgcgtgtggtgcgccccgcacgtggttggcgatc
accggcaccaacggaaagaccacaaccacggcgatggctgcagccatgttgtccgagggc
ggctttaaagcagaggccgtgggcaacattggggtctcggtgagcgatgcgctgctggcg
gagccccgaattgatgtcattgtcgcggaactgtccagtttccagctgcactggtcgtcg
acgatccacccggcagctggggtgctgttgaacttggctgatgatcacatcgattggcac
ggaagtttcgatgcctatgcgctggccaaagccaagttgcttgatagcgatgttgcgatt
atttcccgtgatgacgccgcggtggtgcgggtcgctggcgcccgcgacgttatcgctttt
ggtagcggcattccgctggacggcgagctcggtgtggaagatgggatgctcgttgaccgt
gcgttcggtggaggagtgctagctagcgccgaggggatttccccggcaggaccggcgggc
gtgtacgatgcgttggcggcagcggcattggcgcgttcgcagggcgttgaaccgcaggct
atcgcccgcgcattggatacttttgaagtttccgggcaccgtggccaggtggtacacgaa
cataacggggtggcttttgttgataattccaaggccaccaatccacacgctgcggatgcc
gcactgcgtggccaaagtggagtgcactgggttgctggtggccagctcaagggtgcggat
gttgccgagctagtgcgcgagcacgcaccgcatatggcagcagcctacttgatgggggtc
gatcgcgaggtaatccgccaagcgctgctggatgcccgccccgatctacccattgtcgtg
acagacagcaccgacccggtggcagccacggaggaacttgtcgctgcggcagctgctgcg
gcccaacccgggcaatctgtggtgctggcgccggccgcggcgtcattagacatgtttaca
ggtatggggcagcgcggtgacctgttcgccgatgccgccaggaggtttgcgcgatga

DBGET integrated database retrieval system