KEGG   Corynebacterium argentoratense: CARG_08375Help
Entry
CARG_08375        CDS       T02821                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
caz  Corynebacterium argentoratense
Pathway
caz00071  Fatty acid degradation
caz00072  Synthesis and degradation of ketone bodies
caz00280  Valine, leucine and isoleucine degradation
caz00310  Lysine degradation
caz00362  Benzoate degradation
caz00380  Tryptophan metabolism
caz00620  Pyruvate metabolism
caz00630  Glyoxylate and dicarboxylate metabolism
caz00640  Propanoate metabolism
caz00650  Butanoate metabolism
caz00900  Terpenoid backbone biosynthesis
caz01100  Metabolic pathways
caz01110  Biosynthesis of secondary metabolites
caz01120  Microbial metabolism in diverse environments
caz01130  Biosynthesis of antibiotics
caz01200  Carbon metabolism
caz01212  Fatty acid metabolism
caz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:caz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CARG_08375
   00630 Glyoxylate and dicarboxylate metabolism
    CARG_08375
   00640 Propanoate metabolism
    CARG_08375
   00650 Butanoate metabolism
    CARG_08375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CARG_08375
   00072 Synthesis and degradation of ketone bodies
    CARG_08375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CARG_08375
   00310 Lysine degradation
    CARG_08375
   00380 Tryptophan metabolism
    CARG_08375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CARG_08375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CARG_08375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CARG_08375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caz04147]
    CARG_08375
Enzymes [BR:caz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CARG_08375
Exosome [BR:caz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CARG_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 16730460
NCBI-ProteinID: AGU15777
UniProt: U3GZW3
Position
1744096..1745346
Genome map
AA seq 416 aa AA seqDB search
MTPPQEHNSTPRDVIIVGAARTPRDVIIVGAARTPIGRLLGALSSVPATELGSTAIARAL
EQAHVDPTEVNAVIMGQVLQAGAGQNPTKQAALGAGIPRKAHTVTVNKVCLSGLTAIIDA
ARMLRLGDAEVVVAGGMESMSQAPHLLKGSRSGTKYGATQLADHMEVDGLSDAGTGISMG
VLTEEYLDTYPVDASERDSCVVDSHNNAASGWERGVFDQEIAPVTVRGRKGDTIVERDEG
IREGMTVEALQKLRPAFNPDGVLTAAHASQISDGAAAVVMCTRAYADEHGLQPLAVLRAH
GQVAGPDASLQAQPGNAINQALSRQGWLAEDLDMIEINEAFADVVVHSGRMLGALGRGGV
INPDGGAIAMGHPIGASGARLAVHAAHALNSGRATRAGIGLCGGGGQGEALLLEAP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccaccccaagagcacaacagcaccccccgcgacgtcatcattgttggggcagca
cgcaccccccgcgacgtcatcattgttggggcagcacgcacccccatcggccgacttctg
ggggcactatcatcagttcccgccacagagctgggcagcaccgccatcgcccgcgcactc
gaacaagcgcatgtagaccccaccgaggtcaacgccgtcatcatgggccaggtgctccag
gcaggtgccggacaaaaccccaccaaacaagcagccctgggcgccggcatcccccgtaag
gcccacaccgtcacggtcaacaaagtctgcctctccggactcaccgcaattattgacgcc
gcgagaatgctgcgactaggagacgccgaggttgtcgtcgccggaggcatggaatcaatg
tcccaagcaccacacctgctcaaaggctcacgcagcggcacaaaatacggcgccacccaa
ctagccgaccacatggaagtcgacggcctcagtgacgcaggcaccgggatctccatggga
gtgctcaccgaagaatacctggacacctacccagtcgacgcgtcagagcgtgactcctgc
gttgtggattcccacaacaacgcggcatccggctgggaacgcggcgtcttcgatcaagaa
atcgcgcccgtgaccgtccgcggacgaaagggtgacaccattgtcgagcgcgacgaaggc
atccgcgaaggcatgaccgtggaagccttgcagaagctgcgccccgcattcaacccggac
ggcgtactcaccgcagcacacgcctcccagatttccgatggcgcagcggcagtagtgatg
tgcacccgggcttacgctgacgagcacggactccaaccgctggcagtactacgcgcccac
ggacaggtcgccggaccggacgcaagcctccaagcgcaacccggcaacgccatcaaccag
gcactatcccggcaaggctggctggccgaagacctcgacatgatcgaaatcaacgaagcg
ttcgctgacgtcgtcgtgcactccggccgcatgcttggggcgctcggcaggggcggcgtc
atcaatcccgatggcggagccatcgccatggggcatcccatcggagccagtggcgcgcgc
ctggccgtccacgcagcacatgcgctgaactcgggacgcgctacacgcgcaggcatcggc
ctgtgtggcggcggtgggcaaggcgaagcattgctactggaagcaccctaa

DBGET integrated database retrieval system