KEGG   Caloranaerobacter azorensis: G3A45_03830
Entry
G3A45_03830       CDS       T06467                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cazo  Caloranaerobacter azorensis
Pathway
cazo00472  D-Arginine and D-ornithine metabolism
cazo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cazo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    G3A45_03830
Enzymes [BR:cazo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     G3A45_03830
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067
Other DBs
NCBI-ProteinID: QIB26511
UniProt: A0A6P1YBF4
Position
complement(699425..699790)
AA seq 121 aa
MKRPDDFETRRQHLKDLTEEELERRFWELAEKIVDPLIELAYKHTSPSIERSVLLRMGFS
SIEAKAIVEGAVDRGLLGKGAGHLVYRLAKEKGMDIHEAGLKLVEGEMWDEVVNIFRGGE
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagaccagatgattttgaaactagaagacagcatttgaaagatttaactgaagaa
gaattagaaagaaggttttgggaattagcagaaaaaatagttgatcctttaatagagtta
gcgtataagcatacttctccttcgattgaaaggtctgtattattacgaatgggattttca
agtatagaagctaaggctattgttgaaggagcggttgatagaggactattaggtaaaggt
gcagggcatttggtatataggcttgctaaagaaaaaggtatggatattcatgaggctggt
ttaaaacttgttgaaggagaaatgtgggatgaagttgttaatatttttagaggaggtgaa
cgttaa

DBGET integrated database retrieval system