KEGG   Clostridium botulinum A ATCC 19397: CLB_3252
Entry
CLB_3252          CDS       T00574                                 

Symbol
pfl
Name
(GenBank) formate acetyltransferase 1
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00620  Pyruvate metabolism
cba00640  Propanoate metabolism
cba00650  Butanoate metabolism
cba01100  Metabolic pathways
cba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLB_3252 (pfl)
   00640 Propanoate metabolism
    CLB_3252 (pfl)
   00650 Butanoate metabolism
    CLB_3252 (pfl)
Enzymes [BR:cba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     CLB_3252 (pfl)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 DUF6440
Other DBs
NCBI-ProteinID: ABS35672
Position
complement(3400091..3402319)
AA seq 742 aa
MFYDSWKKFNEGSWENNINVREFIQNNYTPYYGDHSFLKESTEKTKDLWKQCETLIAEEI
KKGILDVDLDNISAINAFDAGYIDKDNETIVGLQTDKPLKRIINPFGGIRMVKQALEAYD
YKLNPHIKDIFTKYRKTHNDGVFDAYTEEMRKARSAGLLTGLPDAYGRGRIIGDYRRIPL
YGVDFLIKNKEEDLKAVKGEMNETTIRKREEISEQIKALIAMKEMALKYGIDISKPAKNA
EEAVQFLYFGYLAGVKENNGAAMSLGRVSSFIDIYIERDLKQGILTEETAQEIIDQFVIK
LRLVRHLRTPEYNDLFAGDPNWITEAIGGMGLNGETLVTKTSYRFLNTLNNLGPAPEPNM
TILWSQNLPENFKKFCAEMSIKTDSIQYENDDLMRDIYGDDYGIACCVSAMALGKQMQFF
GARCNLAKALLYSINGGVDEKKNIKVIDNINAIEDTMLDYEKVKENYFKVLEYIANLYVN
TMNIIHYMHDKYAYEGGLMALHDTEVERLMAFGVAGLSVVADSLSAIKYAKVKPVRENGI
AVDFEIEGDFPKYGNDDDRVDEIAVEIVNKFINELKKNKTYRNAKHTLSVLTITSNVVYG
KKTGSTPDGRKSGEAFAPGANPMHGRDKNGALASLNSVAKIPYKNICEDGVSNTFSIVPD
ALGKSEEERINNLVSILDGYFVQNAHHLNVNVLNRDLLIDAMEHPEKYPSLTIRVSGYAV
HFNRLTKAQQLEVISRTFHKDM
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgttttatgattcatggaaaaaatttaatgaaggttcatgggaaaataatataaatgta
agagagtttatacaaaataattatacgccttattatggagatcatagctttttaaaggaa
tctactgaaaaaacgaaagatctttggaaacaatgcgaaacattaatagcagaagaaata
aaaaaaggaatattagatgtagatttagataatatttctgctataaatgcttttgatgca
ggatatatagacaaggataatgaaaccatagtaggtcttcagacagataaaccactaaaa
agaattataaatccttttggtggtataagaatggtaaaacaagctttagaagcctatgat
tataagttaaacccacacataaaggatatatttaccaaatatagaaaaacccataatgat
ggtgtttttgatgcttatactgaagagatgagaaaagccagaagtgcaggattattaaca
gggcttccagatgcctatggaagagggagaataataggtgattatagaagaataccatta
tatggggtagattttttaataaaaaataaagaagaagatttaaaagctgttaaaggggaa
atgaatgaaactaccataagaaaaagagaagagataagcgaacaaataaaagctttaata
gctatgaaagaaatggcactaaagtatggaatagacataagcaagccagctaaaaatgca
gaagaagcagtacaatttttatattttggttatttagcaggagttaaagaaaataatgga
gcagcgatgtccttaggaagagtaagttcatttatagatatatatatagaaagagacttg
aaacagggaatactaacagaagaaacagcgcaagaaattatagatcagtttgttataaaa
ttaagattagtaagacatcttagaacaccagagtataatgatctttttgcaggagatcct
aactggattacagaagctatagggggaatgggattaaatggggagactttagttactaaa
acatcctatagattcttaaatactttaaataatttaggaccagcaccagaacctaatatg
acgatattatggtcacaaaacttaccagaaaactttaaaaaattctgtgcagaaatgtct
ataaagacagattctattcaatatgaaaatgacgatttaatgagagatatatatggagat
gattatggtatagcttgttgtgtatcagctatggccttgggaaaacagatgcaatttttc
ggtgcaagatgcaatttagccaaagctttattgtattccataaatggtggagtagatgaa
aagaagaatattaaagtaatagacaatataaatgcaatagaagatactatgttagattat
gaaaaagttaaggaaaattattttaaagtattagaatatatagcaaatttatatgtaaat
actatgaatataatacattatatgcatgataagtatgcttatgaaggtgggcttatggca
cttcatgatacagaagtagaaagacttatggcctttggtgtagctggattgtctgttgta
gcagattcattaagtgctataaaatatgcaaaagtgaaaccagtaagagaaaatggtatt
gctgtagattttgaaatagaaggagatttccctaaatacggtaatgatgatgatagagtt
gatgaaatagcagtggaaatagttaataaatttattaatgaattaaagaaaaataaaact
tatagaaatgcaaaacatacactttcagttttaacaataacttctaatgtagtgtatggt
aagaaaacaggttcaacaccagatggaagaaaatcaggagaagcatttgctccaggtgct
aatcctatgcatggaagagataaaaatggtgctttagcatcattaaattctgtagctaaa
ataccttacaaaaatatttgtgaagatggagtatcaaatacattttctatagttccagat
gcattaggtaaaagtgaagaagaaagaataaataatttagtatctatattagatggatat
tttgtacaaaatgctcatcatttaaatgttaatgtgttaaacagagatctactaatagat
gcaatggaacatccagaaaaatatccatcacttactataagggtatcaggttatgcagtt
cattttaatagattgactaaagcacaacaattagaagtgataagcagaactttccataaa
gacatgtaa

DBGET integrated database retrieval system