KEGG   Clostridium botulinum A ATCC 19397: CLB_1016Help
Entry
CLB_1016          CDS       T00574                                 

Gene name
dhaD
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00561  Glycerolipid metabolism
cba00640  Propanoate metabolism
cba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLB_1016 (dhaD)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CLB_1016 (dhaD)
Enzymes [BR:cba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CLB_1016 (dhaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase GATase_4
Motif
Other DBs
NCBI-ProteinID: ABS32338
Position
complement(1048722..1049852)
Genome map
AA seq 376 aa AA seqDB search
MRKAFICPTKYVQGEDELLNLGYFVKSFGESALLIAHKDDIKRVKDKLDSTAKKFGITFV
ESSFCGECSREEVARLQEIAKNNKCACTIGLGGGKAIDTAKCVAKGNSLIIVPTIAATDA
PTSHSAVLYTPDGAFDDYAYFWQSPTVILIDTTVIANAPTRFLVSGMGDALSTYFEARAT
SNSFSNVNAGLPCGVREGLCPPAKGTNTALTLAKACYKTLLEDGVKAKIASDCNLVTQAL
ENIIETNILLSGLGFESAGLAAAHAIHDGLTILEGTHKYFHGEKVAFGTIAQLVLENAPK
EEIDEVINFCLEIGLPVCLEDIGVDSITDEELMEVAKKSCIEEESIHSMPFKVTPEAVAA
AIITADTLGKKYKSNK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcatttatttgtccaactaaatatgttcaaggtgaagatgaattattaaac
ttaggatattttgtaaagagttttggggaatcagctctattaatagctcacaaagatgac
ataaaacgtgttaaagataaattagattcaactgctaaaaaattcggaattacttttgta
gaaagttcattctgtggagaatgttcaagagaagaagttgcaagattacaagaaatcgca
aaaaataataaatgtgcatgcactataggacttggtggtggtaaagctatagatacagca
aaatgcgttgctaagggtaattcattaataattgttccaacaatagcagctacagatgct
ccaactagccactctgctgtactttacacaccagacggtgcatttgatgattacgcttac
ttctggcaaagtccaactgtaattttaatagatactacagttattgcaaatgctccaaca
agattcttagtttcaggaatgggtgatgcattatcaacatatttcgaagcaagagcaact
tcaaattctttttcaaatgttaatgcaggtttaccttgcggagttagagaaggattatgt
ccaccagcaaaaggaactaacacagcattaacacttgcaaaagcttgttataaaacatta
ctagaagatggtgtaaaagcaaaaatagcatcagattgtaatttagtaacacaagcatta
gaaaacataatagaaacaaatattcttttatcaggactaggttttgaaagtgctggttta
gcagctgctcatgcaatccatgatggattaacaatactagaaggaactcacaaatacttc
catggagaaaaagttgccttcggaacaattgcccaattagttcttgaaaatgcaccaaaa
gaagaaattgatgaagtaataaacttctgcctagaaattggacttccagtttgcttagaa
gatattggtgtagacagcattactgatgaagaacttatggaagtagctaaaaaatcttgt
atagaagaagaatcaatacactctatgccatttaaggtaactccagaagcagtagcagca
gcaataataacagcagatactttaggtaaaaaatataaatcaaataaatag

DBGET integrated database retrieval system