KEGG   Clostridium botulinum A ATCC 19397: CLB_1315
Entry
CLB_1315          CDS       T00574                                 

Definition
(GenBank) putative xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00230  Purine metabolism
cba01100  Metabolic pathways
cba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLB_1315
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ABS33751
Position
1368047..1368520
AA seq 157 aa
MSLKRKIKLTVNDKKYEIEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaacttacagttaatgataaaaagtatgaaatagaaata
gatattagagaatctttatcagaagtattaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgaggga
gtacaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagcgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaataa

DBGET integrated database retrieval system