KEGG   Clostridium botulinum A ATCC 19397: CLB_1650Help
Entry
CLB_1650          CDS       T00574                                 

Gene name
acoC
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00010  Glycolysis / Gluconeogenesis
cba00020  Citrate cycle (TCA cycle)
cba00620  Pyruvate metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
cba01200  Carbon metabolism
Module
cba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_1650 (acoC)
   00020 Citrate cycle (TCA cycle)
    CLB_1650 (acoC)
   00620 Pyruvate metabolism
    CLB_1650 (acoC)
Enzymes [BR:cba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLB_1650 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABS35164
Position
1741787..1743097
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VDEGTVVECLKPVAIIGDKDEDISNLLRESLQDSKGNEVEKEVKESKEEIKDNRKIKKGE
RTKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKIAKDL
GVNLEGIKKDGRIMKDDILEFIQKSIPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKNEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtagatgaaggtacagtagttgaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaagggaatctttgcaagatagtaagggaaatgaggtagaa
aaagaagttaaagaatctaaggaggagataaaagataataggaaaataaaaaaaggagaa
agaacaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatagctaaagattta
ggcgttaatttagaaggtataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctattccttctgtaggagaagatttaatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggatatgactaatttaaaaaggttaaaggaacaaattaaa
aatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagaaggagatgaaatgatttttagaaattattca
aatattggagtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagtggtagagaatggagaaatagtgataaaacctctt
atgagtttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattgtag

DBGET integrated database retrieval system