KEGG   Clostridium botulinum A ATCC 19397: CLB_2156Help
Entry
CLB_2156          CDS       T00574                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLB_2156
Enzymes [BR:cba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CLB_2156
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CLB_2156
    1.1.1.-  
     CLB_2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA 2-Hacid_dh_C Pyr_redox ADH_zinc_N_2 ADH_N_assoc Shikimate_DH Pyr_redox_3 GP68 NAD_binding_7 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABS33405
Position
complement(2302763..2303836)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYEKKDVRVEEIEEPKVVEGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGEIVELGQGVTKFNIGDRVIVEPIVACGKCPACMEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEMSYEDAALVEPMAVALHSARIANFNTGDTALVLG
AGPIGLATIECLKAAGARLIVVLQRKSIRQKYAKRAGADVVLDPNEVNIPEEVKKLTDGL
GVDVAFETTGAKIGFDTGIESLKFEGTMVITSIWEKDTSFNPNVLVFTEKKIVGTLAYRH
EFPATMALMKDGRIKTDGYITKKIALDDIVEEGFGALTGPEKKKHVKIIVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgaaaaaaaagatgtaagagtggaagaaattgaagaacca
aaggtagtagaaggatctgtaaaaattaaagtaaaatggtgtggaatatgtggttccgat
ttacatgaatatttaggaggccctatatttattccagtaggacaacctcatgcgttaagt
ggaacaacagcaccagtagttttaggacacgaattttcaggagaaatagtagaattagga
caaggtgtaacaaaatttaatattggagatagggtaattgttgaacctatagtagcttgt
ggaaaatgtccagcctgtatggaagggaaatataatctttgttcatctttaggttttcat
ggactttgtggaagtggcggtggacttgcagaatatactgtatttccagaggaatttgtt
cataaaattccagatgaaatgtcctatgaggatgcggctttagtagaaccaatggcagta
gcacttcattctgcaagaatagctaattttaatacaggagatacagctttagtattaggt
gcaggaccaataggtcttgctacaatagaatgcttaaaagcagctggagcaagactcata
gtagttttacaaagaaaatctataagacaaaaatatgcaaaaagagcaggggcagatgta
gttttagatcctaatgaagttaatataccagaagaagttaaaaaacttacagatgggtta
ggtgtagatgtagcctttgaaaccacaggagctaagataggatttgatactggtattgaa
agcttaaaatttgaaggtacaatggttataactagtatatgggaaaaggatacaagcttt
aatccgaatgtattagtatttactgaaaagaaaattgtaggaactttagcatatagacat
gaattcccagccactatggcgttaatgaaggatggaagaataaaaacagatggatatatt
acaaagaaaatagctttagatgatatagtagaagaaggatttggggctttaactggaccg
gaaaagaaaaaacatgtaaaaattattgtaactccagataaatcacttttataa

DBGET integrated database retrieval system