KEGG   Clostridium botulinum A ATCC 19397: CLB_2385Help
Entry
CLB_2385          CDS       T00574                                 

Gene name
coaBC
Definition
(GenBank) phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00770  Pantothenate and CoA biosynthesis
cba01100  Metabolic pathways
Module
cba_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CLB_2385 (coaBC)
Enzymes [BR:cba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CLB_2385 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CLB_2385 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein DUF4538 adh_short_C2
Motif
Other DBs
NCBI-ProteinID: ABS32733
Position
complement(2521123..2522310)
Genome map
AA seq 395 aa AA seqDB search
MNKKCVVLGVTGGIASYKALDIVSKLKKLNYDVNVIMTKSALQFIHPLPFQSLSGNMVSK
DMFEEPKAFEIQHISLAKKADMILVAPATANIIGKVANGIADDMLSTTIMAATCPVVFVP
AMNTNMYKNPIVKNNIEKLKGFGYEFINPISGRLACGDVGEGKMADTEDIVEIADSMLYP
IKDLIGKNILVTAGPTLAPIDPVRYITNKSSGKMGYSIAKEARDRGAKVTLVSGPTNLKT
PLGLDIIKVNTNEEMLKAVKDNFERQHIVIKSAAVADYKPKEYKEHKIKKTGDNFNLELI
KDKDILKELGLIKKNQILVGFAAESKDLLDNAKSKLEKKNLDFIVANNILSKETGFASED
NLVTIVSKDGCIKNLEKMSKREVAKEIFDTILNKK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatgtgtagtattaggtgtaacaggaggaatagctagctataaagctcta
gatatagtgagcaaactaaaaaagcttaattatgatgtaaatgtaataatgacaaagtct
gcactacagtttatacatccactaccttttcaaagtttaagtggtaatatggtttcaaag
gatatgtttgaagaaccaaaagcctttgaaatacaacatatatccttagctaaaaaggca
gatatgatattggtagctcctgctacagctaatattattggaaaagtagctaatggtata
gctgatgatatgttatctactactataatggcagctacttgtcctgtagtatttgtacca
gctatgaatacaaacatgtataaaaatcctatagtaaaaaataatatagaaaaactaaaa
ggctttggttatgaatttattaaccctatatctggaagactagcctgtggagatgtaggg
gaaggtaaaatggctgatactgaagatatagtagaaatagcagatagtatgctttatcct
ataaaagacttaatagggaaaaatatactagttactgcagggcctaccctagcacctata
gatccagtaagatacataacaaataaatcttctggaaaaatgggatattctatagcaaag
gaagctagagatagaggtgcaaaggttacattagtatctggccctacaaacttaaaaaca
cctttaggcttggatataataaaagttaatacaaatgaagagatgcttaaagctgttaaa
gataattttgaaaggcagcatatagttataaaatctgcagctgtggcagattacaaacct
aaagaatataaagagcataaaataaaaaaaaccggtgataatttcaatttagagctaata
aaagataaagatattttaaaagaattaggactaataaaaaagaatcaaatattggtaggc
tttgcagcagaaagtaaagatcttttagataatgctaaatctaaattagagaaaaaaaac
ttagattttatagtagcaaataatatcctgtcaaaggaaacaggatttgcatcagaggac
aatttggttacaatagtatctaaagatggatgtattaaaaatttagaaaagatgtctaaa
agagaagtggctaaagagatatttgatactatattaaataaaaaataa

DBGET integrated database retrieval system