KEGG   Clostridium botulinum A ATCC 19397: CLB_3236Help
Entry
CLB_3236          CDS       T00574                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00071  Fatty acid degradation
cba00280  Valine, leucine and isoleucine degradation
cba00310  Lysine degradation
cba00362  Benzoate degradation
cba00380  Tryptophan metabolism
cba00620  Pyruvate metabolism
cba00630  Glyoxylate and dicarboxylate metabolism
cba00640  Propanoate metabolism
cba00650  Butanoate metabolism
cba00900  Terpenoid backbone biosynthesis
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
cba01200  Carbon metabolism
cba01212  Fatty acid metabolism
cba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLB_3236
   00630 Glyoxylate and dicarboxylate metabolism
    CLB_3236
   00640 Propanoate metabolism
    CLB_3236
   00650 Butanoate metabolism
    CLB_3236
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLB_3236
   00072 Synthesis and degradation of ketone bodies
    CLB_3236
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLB_3236
   00310 Lysine degradation
    CLB_3236
   00380 Tryptophan metabolism
    CLB_3236
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLB_3236
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLB_3236
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLB_3236
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cba04147]
    CLB_3236
Enzymes [BR:cba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLB_3236
Exosome [BR:cba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLB_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABS35588
Position
complement(3384905..3386083)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggtcaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggagatggaaaaattgta
gacgagatgataagagatggactatgggaatcttttaatgactatcatatgggaattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagctttcaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaattcaaaacatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system