KEGG   Comamonadaceae bacterium A1: SRAA_0576Help
Entry
SRAA_0576         CDS       T03614                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbaa  Comamonadaceae bacterium A1
Pathway
cbaa00071  Fatty acid degradation
cbaa00072  Synthesis and degradation of ketone bodies
cbaa00280  Valine, leucine and isoleucine degradation
cbaa00310  Lysine degradation
cbaa00362  Benzoate degradation
cbaa00380  Tryptophan metabolism
cbaa00620  Pyruvate metabolism
cbaa00630  Glyoxylate and dicarboxylate metabolism
cbaa00640  Propanoate metabolism
cbaa00650  Butanoate metabolism
cbaa00900  Terpenoid backbone biosynthesis
cbaa01100  Metabolic pathways
cbaa01110  Biosynthesis of secondary metabolites
cbaa01120  Microbial metabolism in diverse environments
cbaa01130  Biosynthesis of antibiotics
cbaa01200  Carbon metabolism
cbaa01212  Fatty acid metabolism
cbaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SRAA_0576
   00630 Glyoxylate and dicarboxylate metabolism
    SRAA_0576
   00640 Propanoate metabolism
    SRAA_0576
   00650 Butanoate metabolism
    SRAA_0576
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SRAA_0576
   00072 Synthesis and degradation of ketone bodies
    SRAA_0576
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SRAA_0576
   00310 Lysine degradation
    SRAA_0576
   00380 Tryptophan metabolism
    SRAA_0576
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SRAA_0576
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SRAA_0576
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SRAA_0576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbaa04147]
    SRAA_0576
Enzymes [BR:cbaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SRAA_0576
Exosome [BR:cbaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRAA_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAO80430
UniProt: A0A060NHY7
Position
complement(583702..584964)
Genome map
AA seq 420 aa AA seqDB search
MQHKGFFNAFDDVWLLDGVRTPMVDYCGALGSVSPTDLGIKAARAVLQRAGVAGAHIGSV
IAGNMAPGDCYQYMLPRHIGLYAGVPVEVPALMVQRICGTGLELLRQAGEQLQGGLCEAA
LVVGCESMTRNPIAAFEHRSGFRLGAPVGFQDYLWEALMDPAPGISMIQTAENLAQQYGI
GRAEVDAFASRSFAQAVAAQAAGFFEDEIVAVVSERFELAGYQTRGIKLPSKTPELRTDT
HPRPSPVEVLAQLKPVYAGGVQTGGNSSALVDAAAAAVVATGAYAQSWAKASGKQPLARL
VSSAVVGVAPEIMGIGPAPAIRLLLARSGLALSDIARIEINEAQGAQTLAVARELGLDME
RLNVNGGAIALGHPLAATGLRLGITLARELRRSQQRWGIASACVGGGQGMALLIENPKAA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacaaaggctttttcaacgcgttcgacgacgtctggttgctggacggcgtgcgc
accccgatggtggattactgcggtgcgctggggtcggtctcgcccaccgatctgggcatc
aaagccgcgcgcgcggtgctgcaacgcgcgggcgtggcgggcgcacacatcggctcggtg
attgcgggcaatatggcaccgggcgattgttaccagtacatgctgccgcgccacatcggt
ctgtatgccggcgtgccggtggaggtgcccgcgctgatggtgcaacgcatctgcggcacc
gggctggagctgctgcgtcaagcgggtgaacaactgcaaggcggcctgtgcgaggccgcc
ctggtggtgggctgcgagagcatgacgcgcaaccccatcgccgctttcgaacaccgcagc
ggcttcaggctcggggcaccggtgggcttccaagactatttgtgggaagcgttgatggac
ccggcccccggcatcagcatgatccaaaccgcagaaaacctggcccagcagtacggcatc
ggccgcgccgaggtcgatgcctttgccagccgctcctttgcccaggcggtggcggcccag
gcagccggctttttcgaggatgagatcgtggccgtggtgagcgagcgcttcgagctggcc
ggctaccaaacgcgcggcatcaaattgccgtccaaaacacccgaactgcgcaccgatacg
cacccgcgcccctcccccgtggaggtgctggcccaactcaagccggtctatgcaggcggg
gtgcaaaccggcggcaacagctcggcgctggtggatgcggcggcggcggcggtggtagcc
accggcgcctacgcccaaagctgggccaaggccagcggcaaacaacccttggcgcgcctg
gtgtccagcgcggtggtgggggtggcgcccgagatcatgggcatcgggccggcacccgcc
attcgcttgctgctggcgcgctccggcctggcgctgtccgacatagcccgcattgaaatc
aacgaagcccaaggcgcgcagacgctggcggtggcgcgcgagctggggctggatatggag
cgcctgaacgtcaacggcggcgccatcgcgctcggccatccgctggccgccaccgggctg
cgtctgggcattacactggcgcgcgagctgcgccgcagccagcagcgctggggcatcgcc
agcgcctgcgtgggcggtggccaaggcatggcgttgttgatcgaaaaccccaaggctgcg
tga

DBGET integrated database retrieval system