KEGG   Serpentinomonas raichei: SRAA_2004Help
Entry
SRAA_2004         CDS       T03614                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cbaa  Serpentinomonas raichei
Pathway
cbaa00471  D-Glutamine and D-glutamate metabolism
cbaa00550  Peptidoglycan biosynthesis
cbaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SRAA_2004
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SRAA_2004
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbaa01011]
    SRAA_2004
Enzymes [BR:cbaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SRAA_2004
Peptidoglycan biosynthesis and degradation proteins [BR:cbaa01011]
 Precursor biosynthesis
  Amino acid ligase
   SRAA_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C XdhC_C 3HCDH_N AlaDh_PNT_C CbiA
Motif
Other DBs
NCBI-ProteinID: BAO81858
UniProt: A0A060NQT3
Position
complement(2153689..2155596)
Genome map
AA seq 635 aa AA seqDB search
MNTRPFPPASAVPDPSAAAALPGASQPDWLRLALAPAAQALHGRPVLVLGLGASGLALAR
WCALAGAQVTVADTRASAPQAAVLAAEAPQTTVRLQTRFDAALFAAAPWALVCRSPGILP
SDMAGLAAAAQQAGVTIVGELGLFGQALEALGGAQDLAGSLDGTAAATGPGLGRGSSVTR
SDSSPRPSPGPATTAAAPCTHELLADSAHRPSAAPAAHASTPGRSSAANANAQSSPTPTY
RPHVLAITGTNGKTTTTALTAHLLRAAGWSVAVAGNIGPTLLDELRQRLHSGDLPQAWVL
ELSSFQLDAVQGFEASAATVLNLSEDHLDWHGNMAAYGAAKARIYGQRALMLLNRDDPTV
MGWCPQAPASVTTAGGKARRHAAKATAPSAPARPYVTFGTDAPQRPGDWGLQTVNGLTWL
VRAQVSGEPARTPTASALRLQALMPAEALRIRGRHNASNALAALALATAVGAPLAALLHG
LRDYRGEPHRVEPVGIVADIEYIDDSKGTNVGATLAALNGLGVERRLVLILGGDGKGQDF
KPLAPAVARYVRAVALIGRDAAALEAVLGASGVPLQRCTTLPEAVRWCAAQARPGDAVLL
SPACASLDMFRDYAHRAEVFVATVRALQQEGGTPT
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccggccgttccccccagccagcgccgtgcccgaccccagcgcggccgctgcc
ctgcccggcgccagccagccggactggctgcgcttggcgctggctccggcggcgcaggcg
ctgcatgggcggccggtgctggtgctgggcctaggcgcatccgggctggcgctggcgcgc
tggtgtgcgctggccggggcgcaggtcacggtggccgacacccgcgccagcgcgccccaa
gccgccgtgctggccgccgaagcgccgcagaccaccgtgcgcctgcaaacgcgcttcgac
gccgccttgttcgccgccgccccgtgggcgctggtgtgtcgcagccccggcattttgccc
agcgacatggccgggctggccgccgccgcgcagcaagccggggtgacgatcgtgggcgag
ctgggcttgttcggtcaggcgctggaggcgttgggcggggcgcaggacttggctgggtct
ttggatgggacggctgcggcgacggggcccgggctgggccggggttcgtcagtcacacgt
tccgattcctcaccccggcccagcccgggccccgccaccacagccgcagccccgtgcacg
catgagttgctcgccgattccgcgcaccggcccagcgcagcccccgctgcgcacgccagc
accccaggccgcagcagcgccgccaacgccaacgcccaaagcagcccgacccccacatac
cgcccccacgtgctcgccatcaccggcaccaacggcaaaaccaccaccaccgcgctcacc
gcacacctgctgcgcgcggccggctggtcggtggcggtggcgggcaacatcggcccgacc
ctgctcgacgaactgcgccagcgcctgcacagcggcgacttgccgcaagcctgggtgctc
gagctctccagcttccagctcgacgcggtgcagggcttcgaggccagcgccgccaccgtg
ctcaacctgagcgaagaccacctcgactggcacggcaacatggccgcctacggggccgcc
aaggcgcgcatctacggccagcgcgccctgatgctgcttaaccgcgacgaccccaccgtc
atgggctggtgcccgcaagccccggcctctgtcaccacagcaggcggcaaagcgcgccgc
cacgctgccaaagccactgcaccgagtgccccggcacgtccctacgtcacattcggcacc
gatgcgccccagcgccccggcgactggggcttgcagaccgtcaacggcctcacttggctg
gtgcgtgcccaagtcagcggcgagcccgcccgcacaccaacagccagcgccctgcggctg
caagccctcatgcccgccgaggccttgcgcatccggggccgccacaacgccagcaacgcg
ctggcggcgctggcgctggcgaccgcggtcggggctccgctggcggcgctgctgcacggc
ttgcgcgactaccgcggcgagccgcaccgggtcgagccggtcggcatcgtggccgacatc
gaatacatcgacgacagcaaaggcaccaacgtcggtgccacactggcagcactcaacggg
ctcggggtcgagcggcggctggtgctgattttgggcggcgacggcaaagggcaagacttc
aaaccgctggccccggccgtggcgcgctacgtgcgcgcggtggcgctgatcgggcgcgat
gccgccgccctcgaggcggtgctgggtgccagcggcgtgccgctgcaacgctgcaccacc
ttgcccgaagccgtgcgctggtgcgccgcccaagcgcgccccggtgacgcggtgctgctc
tcgccggcttgcgccagcctcgatatgtttcgcgactacgcgcaccgcgccgaggtcttc
gtggccacagtgcgcgcgctgcagcaggaagggggcacgcccacatga

DBGET integrated database retrieval system