KEGG   Serpentinomonas raichei: SRAA_2063Help
Entry
SRAA_2063         CDS       T03614                                 

Gene name
apaG
Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
cbaa  Serpentinomonas raichei
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SRAA_2063 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: BAO81917
UniProt: A0A060NJX5
Position
complement(2225327..2225725)
Genome map
AA seq 132 aa AA seqDB search
MWPMSRYQFTCEAEPQYVPEQSDPQAPLYLFAYTITIRNSGEVAAQLVARHWEIEDARGQ
TQQVDGLGVVGHQPLLQPGQSFRYSSSVPLRTPMGLMSGHFFCVAVDGQRFEAPVAAFVL
RADGEAGRSSLH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccatgtcacgttaccaattcacttgcgaagccgagccgcagtatgtgccggag
cagtccgacccgcaggcgccgctgtacctgtttgcctacaccatcaccatccgcaacagc
ggcgaggtggcggcgcaactggtggcgcggcactgggagatcgaagacgcgcgcggccag
acgcagcaggtcgatgggctgggcgtggtcgggcaccaacccctgttgcagccggggcag
tcgtttcgctacagcagcagcgtgccgctgcgcaccccgatggggctgatgagcgggcat
tttttctgcgtcgccgtcgatgggcagcgcttcgaggccccggtggcggccttcgtgctg
cgcgccgatggggaagcaggccgctcttcgctgcactga

DBGET integrated database retrieval system