KEGG   Comamonadaceae bacterium B1: SMCB_1088Help
Entry
SMCB_1088         CDS       T03627                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00071  Fatty acid degradation
cbab00072  Synthesis and degradation of ketone bodies
cbab00280  Valine, leucine and isoleucine degradation
cbab00310  Lysine degradation
cbab00362  Benzoate degradation
cbab00380  Tryptophan metabolism
cbab00620  Pyruvate metabolism
cbab00630  Glyoxylate and dicarboxylate metabolism
cbab00640  Propanoate metabolism
cbab00650  Butanoate metabolism
cbab00900  Terpenoid backbone biosynthesis
cbab01100  Metabolic pathways
cbab01110  Biosynthesis of secondary metabolites
cbab01120  Microbial metabolism in diverse environments
cbab01130  Biosynthesis of antibiotics
cbab01200  Carbon metabolism
cbab01212  Fatty acid metabolism
cbab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbab00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMCB_1088
   00630 Glyoxylate and dicarboxylate metabolism
    SMCB_1088
   00640 Propanoate metabolism
    SMCB_1088
   00650 Butanoate metabolism
    SMCB_1088
  Lipid metabolism
   00071 Fatty acid degradation
    SMCB_1088
   00072 Synthesis and degradation of ketone bodies
    SMCB_1088
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMCB_1088
   00310 Lysine degradation
    SMCB_1088
   00380 Tryptophan metabolism
    SMCB_1088
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMCB_1088
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMCB_1088
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SMCB_1088
Enzymes [BR:cbab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMCB_1088
Exosome [BR:cbab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMCB_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAO83316
UniProt: A0A060NLC3
Position
complement(1168310..1169485)
Genome map
AA seq 391 aa AA seqDB search
MSHALIVSTARTPLAKSWKGSFNLTHGATLGGHAVRHAIARAGIDPAAVEDVIMGCANPE
GATGMNIARQIALAAGCPVSTSGLTVNRFCSSGLQTIALAAQRIIAGEGEVYVAGGVESI
SCVQQEMNQHMLIDPALQQAKPAIYWSMLQTAEQVAQRYGIGREAMDEYGAASQQKACAA
QAAGRFADEIAPIEVRAGVADKTLGLITRTVSVSLDEGLRAGTTREGISGIKPALPGGVV
AAGNASQFSDGAGACVLMHESLVQKQGLQPLGRFLGFAVAGCEPDEMGIGPVFAVPKVLA
KLGLKVDDIELWELNEAFAVQVLYCRDRLGIPNERLNVNGGAIALGHPYGVSGQRLTGHA
LIEGKRRGAKRVCVTMCIGGGMGAAGVFEVL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgccctcatcgtatccaccgcacgcaccccgctggccaaaagctggaaaggg
tctttcaacctcacccatggggccacgctgggcggccatgcggtgcgccatgccattgcc
cgcgccggcatcgatccggccgcggtcgaagacgtgatcatgggctgtgccaaccccgaa
ggggccaccggcatgaacatcgcgcgccagatcgcgctcgccgccggttgcccggtgagc
acctccggcctcacggtgaaccgcttttgctcctcgggcctgcaaaccatcgcgctggcg
gcgcagcgcatcatcgccggcgagggcgaggtctatgtcgccgggggtgtcgagagcatt
tcgtgcgtgcagcaggaaatgaaccagcacatgctgatcgacccggcgctccagcaggcc
aaaccggcgatctactggagcatgctgcaaaccgccgaacaggtggcgcagcgctacggc
atcgggcgcgaggcgatggacgaatacggtgccgccagccagcaaaaagcctgcgccgca
caggccgcagggcgctttgccgacgagatcgcgcccatcgaggtgcgcgccggcgtggcc
gacaaaaccctgggcctgatcacgcgcaccgtcagcgtgagcctagacgaaggcctgcgc
gctggcaccacgcgcgagggcatcagcggcatcaaaccggcgctgcccggtggcgtggtg
gccgccggcaacgccagccagttcagcgacggcgccggcgcctgcgtgctgatgcacgaa
agcctggtgcaaaaacagggcttgcagccgctgggccgcttcctcggctttgccgtggcc
gggtgcgagcccgacgaaatgggcatcggcccggtgtttgccgtgcccaaggtgctggcc
aaattgggcctcaaggtcgatgacatcgaactgtgggagctcaacgaagcctttgccgtg
caggtgctttattgccgcgaccggctcggcatccccaacgagcggctcaacgtcaacggc
ggcgcgatcgcgctcggccacccctacggcgtctcgggccagcgcctgaccggccacgcg
ctgatcgagggcaagcggcgcggcgccaaacgggtgtgcgtaaccatgtgcatcggcggc
ggcatgggcgcggctggggtatttgaggtgctgtaa

DBGET integrated database retrieval system