KEGG   Serpentinomonas mccroryi: SMCB_1195Help
Entry
SMCB_1195         CDS       T03627                                 

Definition
(GenBank) uncharacterized bacitracin resistance protein
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
cbab  Serpentinomonas mccroryi
Pathway
cbab00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SMCB_1195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbab01011]
    SMCB_1195
Enzymes [BR:cbab01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     SMCB_1195
Peptidoglycan biosynthesis and degradation proteins [BR:cbab01011]
 Precursor biosynthesis
  Diphosphatase
   SMCB_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA TauE
Motif
Other DBs
NCBI-ProteinID: BAO83423
UniProt: A0A060NV66
Position
complement(1290658..1291491)
Genome map
AA seq 277 aa AA seqDB search
MDIVLLLKAAVMGLVQGITEFLPISSTGHLILTSALLGLYGEKVRLFEVVIQVGALLAIV
SVYLERLLDTAKGLPRGDAVAWRFTSNLVIGCLPAVILGVLFFDFITGVLFNPLVVAFSF
ISGGLVILWVEARQARQPPQRIQEVDAVGWRDSLTVGLIQCLALVPGVSRSGATIVGAMA
FGFSRRAATEFSFFLSIPMLVGAAGYDLYKNADLLTRADLPFFAVGMVVTWLSAWACVRW
LLRYVAQHTFVPFAWYRIGFGLLVLLTAYMGWVDWTR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgttttgctgctcaaggccgccgtgatggggctggtgcagggcatcaccgag
tttttgccgatttcttccaccgggcacctgatcctgacctcggccttgctcgggctctac
ggcgagaaggtgcggctgttcgaggttgtgatccaggtcggggcgctgctggccatcgtc
tcggtctatctggagcggttgctggacactgccaaggggctgccgcgtggcgacgccgtg
gcttggcgcttcaccagcaacctcgtcatcggctgcctgccggcggtaatcctgggagtg
ctgttcttcgacttcatcaccggcgtgctgttcaacccgctggtggtggccttcagtttc
atctcgggcgggctggtgatcctgtgggtcgaggccaggcaggcgcgtcagccgccgcag
cgcatccaagaggtcgacgcggtgggctggcgcgattcgctcaccgttgggctgattcag
tgcctggcgctggtgccgggtgtgagccgctcgggggccaccatcgtcggggccatggcc
tttggcttttcgcgccgcgccgccaccgagttcagtttttttctctcgatcccgatgctg
gtcggggcagcgggctatgacctgtacaaaaacgccgatctgctcacccgcgccgacctg
ccgttttttgccgtcggcatggtcgtgacttggctttcggcttgggcttgcgtgcgctgg
ctgctgcgttacgtggcgcagcacacttttgtgccctttgcctggtaccgcatcggcttt
gggctgctggtgctgctcacggcctacatgggctgggtggactggacgcgctaa

DBGET integrated database retrieval system