KEGG   Comamonadaceae bacterium B1: SMCB_1784Help
Entry
SMCB_1784         CDS       T03627                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00640  Propanoate metabolism
cbab00650  Butanoate metabolism
cbab00900  Terpenoid backbone biosynthesis
cbab01100  Metabolic pathways
cbab01110  Biosynthesis of secondary metabolites
cbab01120  Microbial metabolism in diverse environments
cbab01130  Biosynthesis of antibiotics
cbab01200  Carbon metabolism
cbab01212  Fatty acid metabolism
cbab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMCB_1784
   00630 Glyoxylate and dicarboxylate metabolism
    SMCB_1784
   00640 Propanoate metabolism
    SMCB_1784
   00650 Butanoate metabolism
    SMCB_1784
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMCB_1784
   00072 Synthesis and degradation of ketone bodies
    SMCB_1784
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMCB_1784
   00310 Lysine degradation
    SMCB_1784
   00380 Tryptophan metabolism
    SMCB_1784
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SMCB_1784
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMCB_1784
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SMCB_1784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbab04147]
    SMCB_1784
Enzymes [BR:cbab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SMCB_1784
Exosome [BR:cbab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SMCB_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAO84012
UniProt: A0A060NQH3
Position
complement(1918726..1919916)
Genome map
AA seq 396 aa AA seqDB search
MNPAADPIVIVSAARTPMGSLQGDFAALAAHDLGGVAIAAAVARAGIAPELVTEVLMGNC
LLAGQGQAPARQAAFKGGLPDSAGAVTLSKMCGSGMRAAMFAHDMLLAGSHEVLIAGGME
SMSNAPYLLAKARGGYRIGHDRLYDHMMLDGLEDAYEPGRSMGTFGEDCAAHYGFTRAQQ
DAYASASVQRAQRAIQDGSFADEIAPVTLQERSGAREVHIDEGPGRIKLDKIPTLKPAFK
KDGTVTAASSSSINDGAAALLLMRASTAQRLGCTPLVRVCAHATHAQAPQWFSTAPVGAS
LKLLAKLGWTADEVDLWEVNEAFAVVAMALMHDLKVPHERVNVNGGACALGHPIGASGAR
ILVTLIHAMRARNARRGVATLCIGGGEATAMALELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagccgccgacccgatcgtcatcgtttccgccgcccgcaccccgatgggcagt
ttgcagggcgactttgccgcgctggcggcgcacgatctgggcggggtggcgatcgccgcc
gcagtggcgcgcgccggcatcgcgcccgagctcgtcaccgaggtgctgatgggcaactgc
ttgctggctggacaaggccaagcgccggcgcgccaagcggctttcaagggcggcttgccc
gacagcgccggcgccgtgacgctgtccaaaatgtgcggctccggcatgcgcgcggccatg
tttgcgcacgacatgctgctggccggcagccacgaggtgctgatcgccggtggcatggag
agcatgagcaacgccccctacctgctggccaaggcgcgcggcggctaccgcatcggccac
gaccgactctacgaccacatgatgctcgacggcctcgaggacgcctacgaaccggggcgc
agcatgggcaccttcggtgaagactgcgccgctcactacgggttcacccgcgcccagcaa
gacgcctacgccagcgccagcgtgcagcgcgcccagcgcgcgattcaggacggcagcttt
gcagatgaaatcgccccggtcacgctgcaagagcgcagcggcgcgcgcgaggtgcacatc
gatgaagggccgggccgcatcaagctcgacaaaatccccacgctcaagccggccttcaaa
aaagacggcaccgtgaccgccgccagcagctccagcatcaacgacggcgccgccgcgctg
ctgctcatgcgcgccagcacggcgcagcggctcggttgcacgccgctggtgcgcgtctgc
gcccacgccacccacgcccaagcgccgcagtggttttctaccgcgccggtgggcgcgagc
ctaaagctgctggccaagctgggctggacggcagacgaagtcgatctgtgggaagtcaac
gaggcctttgccgtggtggcgatggcgctgatgcacgacctaaaagtgccgcacgagcgc
gtcaacgtcaacggcggcgcctgcgcgctggggcacccgatcggggccagcggcgcgcgc
atactggtcacgctcatccacgccatgcgcgcccgcaacgcccggcgcggcgtggccacg
ctgtgcatcggcggcggcgaggccacggcgatggcgctggaattggtttaa

DBGET integrated database retrieval system