KEGG   Serpentinomonas mccroryi: SMCB_2133Help
Entry
SMCB_2133         CDS       T03627                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cbab  Serpentinomonas mccroryi
Pathway
cbab03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SMCB_2133 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbab03011]
    SMCB_2133 (rplV)
Ribosome [BR:cbab03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SMCB_2133 (rplV)
  Bacteria
    SMCB_2133 (rplV)
  Archaea
    SMCB_2133 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: BAO84361
UniProt: A0A060NPA1
Position
complement(2308818..2309147)
Genome map
AA seq 109 aa AA seqDB search
METRAIARGVRLSVDKGRLVADLIRGKKVDQALHILNFTQKKAAGIVKKALESAIANAEH
NDGADIDELKVKIIHVEQGTTLKRFSARAKGRGNRISKPTCHIYVTVGT
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgcgcaatcgctcgcggcgtccgcctctcggtggacaagggccgcctggtg
gccgacctgattcgaggcaaaaaagtcgatcaggcgctgcacattctcaacttcacgcaa
aagaaggccgctggcatcgtcaagaaggcgctggagtcggccattgccaacgccgagcac
aacgacggcgccgacatcgacgaactgaaggtgaaaatcatccacgtcgaacaaggcacc
acgctcaagcgtttctcggctcgcgccaagggccgcggcaaccgcatcagcaaaccgacc
tgtcacatctacgtgacggtgggcacctaa

DBGET integrated database retrieval system