KEGG   Coriobacteriaceae bacterium 68-1-3: JI75_02775Help
Entry
JI75_02775        CDS       T03545                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cbac  Coriobacteriaceae bacterium 68-1-3
Pathway
cbac00670  One carbon pool by folate
cbac01100  Metabolic pathways
cbac01120  Microbial metabolism in diverse environments
cbac01200  Carbon metabolism
Module
cbac_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cbac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    JI75_02775
Enzymes [BR:cbac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     JI75_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: AJC11750
UniProt: A0A0A8B2W5
Position
complement(620521..622188)
Genome map
AA seq 555 aa AA seqDB search
MKSDIEIAQETETSPISDVAAKLGIPERYLEMYGSRKAKVDYNYLRENPSEPGKLVLVTA
INPTAAGEGKTTTTVGLGDALSRMGKKTVIALREPSLGPVFGIKGGAAGGGYAQVVPMED
INLHFTGDFHAIGAANNLLAAMIDNHIHQGNALGFDARKITWKRAVDMNDRALREIVVGL
GGKVNGFPRQDGFDITVASEIMAVFCLSTSISDLKERLARMVVGYTFDDQPITAGQLNAQ
GAMAALLKDALKPNLVQTLEGTPAFVHGGPFANIAHGCNSIMATNMALALGDYTVTEAGF
GADLGAEKFLDIKCRLTGVRPSAVVVVATVRALKMHGGADKKQLGDENLEALEAGLPNLL
QHVENVTGVFKLPCVVAINRFPTDTDAEVALIADRCRELGVNVALSEVWEKGGAGGAALA
EEVVRLCEQESELEFAYDAEAGIADKIEAIAKRIYRAEGVTIEPKVLKEIAKLESLGFGK
LPVCMAKTPASFTDDAARIGAPRGFRISVRDVKVSAGAGFVVALTGSIMTMPGLGKSPAA
ERIDVDETGRIVGLF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgacatcgaaatcgcccaagagaccgaaacctccccgatctcagacgtcgct
gcgaaactggggataccggagcgctaccttgagatgtacggcagccgcaaggcgaaggtc
gactacaactacctgcgcgagaacccgagcgaacccggcaagctcgtcttggtgaccgcc
atcaaccccaccgccgccggcgaggggaagaccacgacgacggtcggtttgggcgacgcg
ctttcccgcatggggaaaaagacggtcatcgccctgcgcgaaccgtccctcggaccggtg
ttcggcatcaaggggggcgcggccgggggcggatacgcccaggtcgttcccatggaagac
atcaacttgcacttcaccggcgacttccatgccatcggagccgccaacaacctgctcgcg
gccatgatcgacaaccacatccaccagggcaacgcgctcgggttcgacgcgcgcaagatc
acctggaagcgcgccgtggacatgaacgaccgagccctgcgcgagatcgtggtgggcctg
ggcggcaaggtgaacgggttcccgcgccaagacgggttcgacatcaccgtcgcaagcgag
atcatggccgtgttctgcctgtccaccagcatcagcgacctcaaagagcgtctcgcgcgc
atggtggtcggatacacctttgacgaccagcccatcaccgccggccagctgaacgcccag
ggcgcgatggccgcgcttctgaaagacgcgctgaagccgaacctggtccagaccctcgag
ggcacgcccgccttcgtccacggcggccccttcgccaacatcgcccacggctgcaactcc
atcatggcgaccaacatggcgctcgctttgggcgactacacggtaaccgaggcggggttc
ggcgccgacctgggggccgagaagttcctcgacatcaagtgccgcctcacgggcgtgcgc
cccagcgccgtcgtggtggtcgccaccgtccgcgcgctgaagatgcacggcggagccgat
aagaagcagctgggagacgagaacctcgaagcgctcgaggcaggtctgcccaacctgctg
cagcacgtcgaaaacgtcaccggcgtattcaagctgccctgcgtcgtggccatcaaccgc
ttccccaccgacaccgacgccgaggtcgccctcatcgcggatcgctgccgcgaactgggc
gtgaacgtcgctctgtccgaagtgtgggaaaaaggcggagcgggcggagcggcgcttgcc
gaagaggtcgtccgcctgtgcgagcaggaaagcgagctggaattcgcctacgacgccgag
gccgggatcgccgacaagatcgaggccatcgcgaagcgcatctaccgagccgaaggcgtg
acgatcgagccgaaggtgctcaaggagatcgccaagctcgaatccctcggtttcgggaag
ctccccgtctgcatggcgaagacgcccgccagcttcaccgacgacgccgcgcgcatcggc
gccccgcgcggtttccgcatctctgtgcgcgacgtgaaggtaagcgccggcgccggcttc
gtcgtggcgctcaccggcagcatcatgaccatgccggggctgggcaagtcccctgccgcc
gagcgcatcgacgtcgacgagacgggtcgcatcgtcgggctcttctaa

DBGET integrated database retrieval system