KEGG   Coriobacteriaceae bacterium 68-1-3: JI75_07705Help
Entry
JI75_07705        CDS       T03545                                 

Definition
(GenBank) amino acid adenylation protein
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
cbac  Coriobacteriaceae bacterium 68-1-3
Pathway
cbac00473  D-Alanine metabolism
cbac01100  Metabolic pathways
cbac01503  Cationic antimicrobial peptide (CAMP) resistance
cbac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JI75_07705
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JI75_07705
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    JI75_07705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cbac01504]
    JI75_07705
Enzymes [BR:cbac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     JI75_07705
Antimicrobial resistance genes [BR:cbac01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    JI75_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AJC12558
UniProt: A0A0A8B6Z6
Position
1704152..1705699
Genome map
AA seq 515 aa AA seqDB search
MTNVILNSVRKTALENPGAPIHRMAGAREVTYGQAWDMAGRIAGKLREKTSGREPVMVYG
HKSSLMVVSFLACLRAGHAFVPIDSELPSSRVVDIARQLDFPPIICAEQAPCDLLEAMPA
NRFLSAADAANGDGSVEDEPEDLWVSGEETHYIIFTSGSTGVPKGIEITANNIERFAAWM
KTFPVVREGGAVFLDQAPYSFDLSEYQVVGALVTGGCLHAVSAETTHDYGLLFSDLRGSQ
VDVWISTPSFADMCLVDPSFSQDILPHARLFLFCGETLHHRTARALRQRFDRALVVNTYG
PTESTVAVTYAEIGEADLNSEDPLTVGSARPGTELRIIDPETGERKPAGESGEIVIVGDT
VAKGYYRSPDKTAAAFFAAHLSNETPVRGYRTGDQGSLDERGNLRFEGRLDHLVKMNGFR
IELGDIECNLTSLEGVEQAAVIPVIRNDQIRSLKAFVVMNSACELDGLELAQDLKARLAG
RIPAYMVPRAFCRLQSMPLTPNAKIDRRALAAMGR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtgattctgaacagcgttcgaaagacagcgctcgaaaacccgggcgcgccg
atccatcgcatggccggtgcacgggaggtcacatacgggcaagcgtgggatatggcgggg
cggatcgccgggaagctgcgcgaaaagacgtccggccgcgagcccgtcatggtgtacggc
cacaagtcgtcgctgatggtcgtatcgtttctcgcctgcctgcgcgcgggccacgcattc
gtccccatcgactcggagcttcccagctcgcgcgtcgtcgacatagcccgtcagcttgat
ttcccccctatcatctgcgctgaacaggcgccctgcgatcttttagaagccatgcccgcg
aaccgcttcctgagcgctgcggacgcggcgaacggagacggctccgtcgaagacgagcct
gaggacctctgggtttccggggaggagacccactacatcatcttcacctcgggctcgacc
ggcgtacccaagggcatcgagatcaccgcgaacaacatcgagcggttcgccgcctggatg
aagaccttccccgtcgtgcgcgaagggggcgccgtcttcctcgaccaggccccctactcg
ttcgatctttccgagtaccaggtggtgggcgcgcttgtcaccggggggtgcctgcacgcc
gtttcggccgaaactacccacgactacgggctgctgttctccgacctgcggggatcgcag
gtcgacgtgtggatctcaactccgtcgtttgccgatatgtgcctggtcgatccctcgttt
tcccaagatatcctgccgcacgcgcggctgttcctgttctgcggggagaccctgcaccat
cgaacggcgcgcgctttgaggcagcgcttcgaccgggcgctcgtcgtcaacacgtacggc
cccaccgaatcgacggtggccgttacctacgcagagatcggcgaggccgatctgaacagc
gaagacccccttaccgtgggctccgcccggcccggaaccgaactgcgcatcatcgacccc
gaaacgggcgagcggaagccggcgggagaatcgggcgagatcgtcatcgtgggcgacacg
gtggccaaggggtactaccgcagccccgacaaaaccgcggcggccttcttcgccgcgcac
ctgtccaacgaaacgcctgtgcgcgggtaccgcaccggcgaccagggctccctcgacgag
cggggaaacctgcgcttcgagggaaggctcgaccatctcgtgaagatgaacggcttccgc
atcgagctgggcgacatcgaatgcaacctgacgtccctcgaaggcgtcgagcaggcagcc
gtcatccccgtcatcaggaacgaccagatcagaagcttgaaggcgttcgtcgtcatgaac
agtgcctgcgagctcgacggactcgagctcgcccaggacctcaaggcccggctggcaggg
cgcatccccgcctacatggttccccgcgccttttgccgcctgcagtccatgcccctcact
cccaacgccaagatcgaccgccgcgcgttggccgccatgggacgataa

DBGET integrated database retrieval system