KEGG   Chitinophaga caeni: COR50_11650Help
Entry
COR50_11650       CDS       T05360                                 

Definition
(GenBank) N-acyl-D-glucosamine 2-epimerase
  KO
K16213  cellobiose epimerase [EC:5.1.3.11]
Organism
cbae  Chitinophaga caeni
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COR50_11650
Enzymes [BR:cbae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.11  cellobiose epimerase
     COR50_11650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlcNAc_2-epim Glyco_hydro_76 DUF1266 C5-epim_C DUF1940
Motif
Other DBs
NCBI-ProteinID: ATL47765
UniProt: A0A291QV02
Position
complement(2740909..2742099)
Genome map
AA seq 396 aa AA seqDB search
MPSSNNQLVTEMKDELKNILHFWKDHTIDQDKGGFYGRLLQDNKVDPYALKGSVLNARIL
WTFAAAAQVTGDPTDILIADKAYQYISDHFVDKEFGGVYWTVDYAGNPVDSKKQVYAIAF
TIYALSEYYKIKQEQDILQMAQQLYQDLQRHAFDPVQKGYFEAFSREWHELKDQRLSLKD
ANEKKSMNTHLHVLEAYTNLYRVWPDQGVKNQIIDLLRVFDEYILDESKTHLQLFFSEDW
SVKGNTVSFGHDIEAAWLMQEAAEVIEDPYYTGLFKAIALKIADSTNSGFDADGGLWYEF
DIDKNHLVKEKHWWPQAEAVVGYVNAWQTSGQPGYLEQALKTWNFIQRYIIDHNYGEWFW
GLDANYKIMPEDKVGIWKCPYHNGRACIEIIKRLDK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaagcaataatcaactggtaacagaaatgaaggatgaattaaagaacatcctt
catttctggaaagaccatacaatagatcaagataaaggaggattttacggacgtttgttg
caggataataaagtagatccatacgcactgaaaggttccgtattaaatgcccgcattttg
tggacatttgccgccgccgcacaggtaacgggcgatccaaccgatatattaatagctgat
aaggcttatcaatatatctcggatcactttgttgataaagaattcggcggggtttactgg
acagttgattatgctggcaatcccgttgattcgaaaaaacaagtgtacgccatcgccttt
actatttatgctttaagtgaatattataaaataaaacaggaacaggacattttacaaatg
gcccagcaattgtatcaagacctgcagcgccatgcattcgatccggtacaaaaggggtat
ttcgaagcgttctcccgcgaatggcatgaactgaaagaccagagattgagcttaaaagat
gcgaacgagaaaaagtcgatgaacacccatctgcatgtcttggaggcttatactaacctt
tacagggtttggccggatcaaggtgtaaaaaatcaaatcattgatcttttacgcgtattc
gatgagtatatcctggatgaatcgaaaacacatctgcaactgtttttttctgaggattgg
agcgtaaaaggaaacactgtttcgttcggtcacgatatagaagcagcttggttaatgcaa
gaagcagctgaagtgattgaagatccgtattatacaggattatttaaagccatcgcgttg
aaaatagccgatagtacaaattccggttttgatgctgacggcggattatggtatgaattt
gatatagacaaaaatcatcttgtaaaagaaaaacattggtggccccaggcggaagcagta
gtcggttatgtcaatgcttggcaaacatccggtcaacccggatatttagagcaagcatta
aaaacttggaattttattcaacgatacattatcgatcataactacggggaatggttctgg
gggcttgatgccaattacaagataatgccggaagataaggtgggcatttggaaatgccct
tatcataatggccgggcttgtatcgaaattattaaaaggttggataaataa

DBGET integrated database retrieval system