KEGG   Cellulophaga baltica NN016038: M667_00120Help
Entry
M667_00120        CDS       T03562                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00051  Fructose and mannose metabolism
cbal01100  Metabolic pathways
cbal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    M667_00120
Enzymes [BR:cbal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     M667_00120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AIY11754
Position
41636..42964
Genome map
AA seq 442 aa AA seqDB search
MATPILITDIETRDVRFPTSKSLDGSDAMNPDPDYSAAYVILKTNHPEGIEGHGLTFTIG
RGNELCVAAINSIAPLIKGKSLESFTKNMGAFWKMITGDSQLRWLGPEKGVIHLATGAIV
NAVWDLYAKVEKKPLWKLLADMSPEELVSCVDFTYITDAITPEEALALLKDKSASKQERI
AHLEQNGYPAYTTSAGWLGYSDDKMRRLCREAKAEGFKHMKIKVGSDLQDDMRRAAIIRE
EIGDDLKLMMDANQKWDVDEAITNMEQLKKFNPWWIEEPTSPDDILGHATIAKAVAPILV
ATGEHCQNRVMFKQLMQAGAIGICQIDSCRVGGVNEILAILLMAAKFKIPVCPHAGGVGL
CEYVQHLSMIDYIAISGSLDDRIIEYVDHLHEHFYDPVILKNGAYMPPKLPGYSITMKEE
SIKDYSFPNGKIWSNETTKTAL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctacacctatactaattacggacattgaaacaagagatgttcgtttccctacaagt
aaatcattagatggctctgacgccatgaatcctgatcctgattattcagctgcctatgtg
attttaaaaacaaatcaccccgaaggtatcgaaggtcatggacttacatttacgattgga
agaggaaatgaattgtgtgttgcggcaatcaattctattgcgcctttaattaaaggtaaa
tctttagaatcattcacgaaaaacatgggggcattttggaagatgattactggcgacagc
caattaaggtggctaggtcctgaaaaaggagtgatacatttagctacgggagctattgta
aatgctgtttgggatttatatgccaaagtggaaaaaaaacctctttggaaacttctagca
gatatgagtcctgaagaattagtgagctgcgtagatttcacctatatcactgatgctatc
actcctgaagaagctttagcgcttcttaaagataaatctgcatctaaacaagaaaggata
gcccacctagaacaaaacggataccctgcctatactacatctgctggctggctagggtat
tctgatgataaaatgagacgcttatgccgcgaagcaaaagcggaaggctttaaacatatg
aaaattaaggtaggctcagatcttcaagatgatatgcgcagagctgcgatcataagagaa
gaaattggtgatgaccttaaattaatgatggatgccaatcaaaaatgggacgttgacgaa
gctattaccaacatggaacaattgaaaaaatttaatccttggtggattgaagaacctacg
agtcctgatgatattcttggtcatgctaccatcgctaaagccgttgccccaattttggta
gctactggagaacattgtcaaaatagagtgatgtttaaacaactcatgcaggctggtgct
ataggtatttgccagatagatagttgtagagttggcggggttaatgagatattagctatc
ttgttaatggccgctaaatttaaaattccagtatgtccacatgctggcggtgtaggttta
tgtgaatacgttcagcacctttcaatgatagattacattgcgataagtggcagtttagac
gatagaataattgaatatgtagatcacttacacgaacatttttacgaccctgtaatcctg
aaaaatggtgcttatatgcctcctaaattacctggctatagcatcacaatgaaagaagaa
tctataaaagactatagctttcctaatggaaaaatttggtctaatgaaacgacaaaaaca
gcgctttaa

DBGET integrated database retrieval system