KEGG   Cellulophaga baltica NN016038: M667_08000Help
Entry
M667_08000        CDS       T03562                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00670  One carbon pool by folate
cbal00790  Folate biosynthesis
cbal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M667_08000
   00670 One carbon pool by folate
    M667_08000
Enzymes [BR:cbal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     M667_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AIY13158
Position
complement(1868952..1869452)
Genome map
AA seq 166 aa AA seqDB search
MKTVTLIAAAAENNALGKDNDLLWHLPDDFKRFKALTTGHPIVMGRKTFESFPKPLPNRT
HIIITRDKNYSTTFENCQIVHSLDAALAVASEIDENIFIIGGGEIYALGLEKATHIELTR
VHTTVEADAFFPDFDKNNWELIKEVHHAKDDKHKYDFTYLTYQSKI
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacagttacactcatagctgctgcagctgaaaataatgccttaggaaaagataac
gacttactatggcatcttcctgatgattttaaaagatttaaagcgcttactactggtcat
cctatagtaatgggaagaaaaacatttgagagcttccctaaaccactacccaatagaact
cacattatcatcaccagagataaaaattactctactacatttgaaaactgccagattgta
cactcgttagatgctgcattagctgttgctagtgaaattgatgaaaatatttttattata
ggcggaggagaaatatatgctttaggacttgagaaagcaacacatatagaacttactaga
gttcataccactgttgaagccgatgcattttttccggattttgataagaataactgggaa
ttgatcaaggaagtgcatcatgctaaagatgataagcacaagtatgattttacctacttg
acctaccaatcaaaaatctaa

DBGET integrated database retrieval system