KEGG   Clostridiales bacterium 70B-A: PATL70BA_0194Help
Entry
PATL70BA_0194     CDS       T05737                                 

Gene name
fda
Definition
(GenBank) Fructose-bisphosphate aldolase class 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00010  Glycolysis / Gluconeogenesis
cbar00030  Pentose phosphate pathway
cbar00051  Fructose and mannose metabolism
cbar00680  Methane metabolism
cbar01100  Metabolic pathways
cbar01110  Biosynthesis of secondary metabolites
cbar01120  Microbial metabolism in diverse environments
cbar01130  Biosynthesis of antibiotics
cbar01200  Carbon metabolism
cbar01230  Biosynthesis of amino acids
Module
cbar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PATL70BA_0194 (fda)
   00030 Pentose phosphate pathway
    PATL70BA_0194 (fda)
   00051 Fructose and mannose metabolism
    PATL70BA_0194 (fda)
  09102 Energy metabolism
   00680 Methane metabolism
    PATL70BA_0194 (fda)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cbar04131]
    PATL70BA_0194 (fda)
   03036 Chromosome and associated proteins [BR:cbar03036]
    PATL70BA_0194 (fda)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbar04147]
    PATL70BA_0194 (fda)
Enzymes [BR:cbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PATL70BA_0194 (fda)
Membrane trafficking [BR:cbar04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PATL70BA_0194 (fda)
Chromosome and associated proteins [BR:cbar03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    PATL70BA_0194 (fda)
Exosome [BR:cbar04147]
 Exosomal proteins
  Proteins found in most exosomes
   PATL70BA_0194 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-ProteinID: VDN46037
UniProt: A0A3P7PND7
Position
1:complement(173902..174789)
Genome map
AA seq 295 aa AA seqDB search
MNIVQFERMKKDDGFIAALDQSGGSTPKALESYGIPKEAYSNEEEMFQLVHEMRSRIMKS
PAFTKDRILAAILFEKTMNMKVGDKYSADYLWEEKGIVPILKVDQGLADLENGVQLMKPM
PNLDTLLIQAEERHIFGTKMRSVIKEANETGIKTLVKQQFDIGKIIWDAGLVPIIEPEID
IHMHDKEKAEEMLKQELLHHLTQLDPEYQVMLKLTIPDVDDFYLEVINHPSALRVVALSG
GYSRNEANEKLSRNHKLIASFSRALSEGLNARQSDDAFNTMMDQSIQSIYEASIT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagtacaatttgaacgtatgaaaaaagacgatggttttattgcagctcttgat
caaagtggcgggagcacaccgaaggcccttgaatcctatggaattcctaaagaagcctat
tcaaatgaagaagaaatgtttcaattggtacatgaaatgcgatctaggattatgaaaagt
ccagcctttacaaaagatagaatacttgctgcaattctttttgaaaagacaatgaatatg
aaagtaggagataaatattctgctgattacttatgggaagagaaaggcattgtacctatt
ttaaaagtggatcaagggttggctgatttggaaaacggcgtgcagttaatgaaaccaatg
ccaaatcttgatacattacttatacaggcagaagaacggcatatttttggtactaaaatg
cgctcagtaataaaagaagccaatgaaaccggaataaaaacattagttaagcaacaattt
gatattggtaagattatttgggatgcaggacttgtgccaattattgaacctgagatagat
attcatatgcatgacaaagaaaaagcggaagaaatgcttaaacaagaattactgcatcac
ctaactcagctcgacccagaatatcaggttatgctaaaacttacgatacctgatgttgat
gatttttatttagaagtcattaaccatcctagtgctcttagagtggttgctttatcagga
ggatactcaagaaatgaggccaatgaaaaactgagtcgcaatcataagttgattgcaagc
ttttcaagagcgttgtctgaaggattaaatgcgaggcaaagtgatgatgcatttaatacg
atgatggatcaatccatccagtctatttatgaggcatccattacataa

DBGET integrated database retrieval system