KEGG   Clostridiales bacterium 70B-A: PATL70BA_0282Help
Entry
PATL70BA_0282     CDS       T05737                                 

Definition
(GenBank) Oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00620  Pyruvate metabolism
cbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PATL70BA_0282
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cbar02000]
    PATL70BA_0282
Enzymes [BR:cbar01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     PATL70BA_0282
Transporters [BR:cbar02000]
 Other transporters
  Primary active transporters [TC:3]
   PATL70BA_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: VDN46127
UniProt: A0A3P7PNP1
Position
1:complement(267035..268447)
Genome map
AA seq 470 aa AA seqDB search
MAEIIKKPIKITDTIFRDAHQSLIATRMTTEDMLPIIQKLDQVGYHSMEVWGGATFDASL
RFLKEDPWERLRSLKKGFKNTKLQMLLRGQNILGYRNYADDVVEYFVQKAIANGIDIVRI
FDALNDTRNLKTAIDATNKEGGHAQVAIAYTLSKVHTIEYFTNLAKELESMGAQSICIKD
MAGLLVPYEAEKLVKALKANVDLPLQIHSHYTSGVASMSYMKAVEAGCDVIDTAISPFAL
GTAQPATEVMVEAFRNTPFDTGFDQELLAEIAEYFRPMREAALDSGLMNPKVLGVNIKTL
LYQVPGGMLSNLVSQLKEQNAEHRFAEVLEEMPRVRADFGFPPLVTPTSQIVGTQAVLNV
LGGERYKLITKESKALVKGEYGRTPVAISPEIVKQIIGEDQQITCRPADLIEPEIDKLRK
EASAYIKQDEDVLSYALFPQVAVDYFNHRDAKLTKVDMTVADKQNKVYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagagattataaagaaacccataaaaattacggatacaatttttagagatgcgcac
cagtctctaattgcaacgcgaatgactaccgaagatatgctcccgattattcagaagttg
gatcaagttggctatcattccatggaagtttggggcggtgctacctttgatgcatctcta
agattcttaaaagaagacccatgggagcgacttagaagtctgaaaaaaggatttaagaac
acgaaattacagatgcttcttagagggcaaaatatactgggctatagaaactatgcagac
gatgtggttgagtattttgtccaaaaggcaattgccaacggtattgatatcgttcgaata
tttgatgctcttaatgatacgcgtaatctaaaaactgcaatagatgctactaataaagaa
ggtggtcacgctcaagtggccatcgcgtatactttatcaaaagtccatactattgagtat
tttacaaatttggccaaagaacttgaatccatgggagcacaatccatctgtatcaaggat
atggccggactactggtaccttatgaagctgagaagttggtcaaagctctaaaagctaat
gtcgatttacctttacaaattcattctcattacacttcaggtgtagcatcgatgtcatat
atgaaagctgttgaagccggatgtgatgttatagatacggcaatatcaccttttgccctt
ggtacagcacaacctgcaactgaggttatggttgaagcttttagaaatacaccttttgat
accggatttgatcaagaactgctggctgagattgcagaatattttagacctatgcgcgag
gcagcccttgattcaggcttgatgaaccctaaagtgttaggcgttaatattaaaacactt
ttgtatcaagtgccgggtggtatgttgtcaaatctcgtttcacaacttaaggaacaaaat
gctgaacaccgttttgcagaagtattagaagaaatgccaagggtaagagcagattttgga
ttcccacctttggtaacacccaccagccagattgtaggaactcaagcggtattaaatgtt
ctgggtggagagcggtataagttgataacaaaagagtcaaaggctttggtcaagggtgag
tatggtcgaacacctgttgctatatcacctgagattgtaaaacaaatcattggtgaggat
caacagattacctgtcgtcctgcagatctaattgaacccgagattgataaactgaggaaa
gaagctagtgcttacattaagcaagatgaagatgtattgtcctatgccttattccctcaa
gtcgctgtggattattttaatcatagggatgcaaaattaacaaaggtagatatgacagtg
gcggataaacaaaataaagtctatcctgtataa

DBGET integrated database retrieval system