KEGG   Clostridiales bacterium 70B-A: PATL70BA_1563Help
Entry
PATL70BA_1563     CDS       T05737                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00260  Glycine, serine and threonine metabolism
cbar01100  Metabolic pathways
cbar01110  Biosynthesis of secondary metabolites
cbar01120  Microbial metabolism in diverse environments
cbar01130  Biosynthesis of antibiotics
cbar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PATL70BA_1563
Enzymes [BR:cbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PATL70BA_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: VDN47448
UniProt: A0A3P7PEV9
Position
1:complement(1563269..1564351)
Genome map
AA seq 360 aa AA seqDB search
MKSEDIQDDKTEWRPNMKTFKSDNTASVHPKIMEAIVKANQEHAIPYGDDPITKEAIDRI
KALFSQPCEVSLVLNGTGANIIGLSTLLKSYEAVICVDTAHINVDECGAFERYTGAKLLT
VPHVNGKLLPEAIDRFLLDKGNEHHNQPKVISISQITELGTLYTTEEIKTLADYAHSHDL
LLHVDGARIANGVAALGISMDEMIGETGVDVLSFGGAKNGMMYGEAIVSFDRSTSNSLKY
TRKQGMQLMSKMRYISAQYIAFLKDDLYLENAHKANNMMKKLYEEIKDIERLEFMSIPYG
NMMFVKMPQTWIDRLLTTFYFYQMTWEEESGMVRLVTSFDTNLEEVEDLIKAIKELNQNN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagtgaagacattcaggatgacaaaacagaatggagacccaatatgaagactttt
aaaagtgacaatacagccagtgtacaccctaaaataatggaagcgattgttaaagccaat
caggaacatgccattccgtatggtgatgatccgattacaaaagaagcgatagatagaatc
aaggctctcttcagtcagccttgtgaagtcagcttggttcttaatggaacaggtgccaat
atcattgggttaagtacattgcttaaatcttatgaagcggtaatttgtgtggatacagca
catattaatgtagatgaatgtggggcttttgaacgttatacaggtgcgaaactcttaacg
gtgcctcatgttaatggcaaattgctacctgaagccattgacagattcttattggataaa
ggcaacgagcatcacaatcaacccaaagttatttctataagtcagattactgaacttgga
acgctttataccacagaagaaataaaaacattagccgattatgcccatagccatgattta
ttattacatgtagatggtgctaggattgccaatggggtagctgctctgggtattagtatg
gatgagatgattggagagacaggtgttgatgtgctctcctttggtggtgccaaaaacggc
atgatgtatggtgaagctattgtttcatttgatcggtcaacaagtaacagtttaaaatac
accagaaaacaaggcatgcaacttatgtccaagatgcgttatattagtgctcagtacatt
gctttcttaaaagatgacctctatcttgaaaatgcgcataaagcaaacaacatgatgaaa
aagctctatgaagaaattaaagacattgaaagacttgaatttatgagtattccatatggg
aatatgatgtttgtaaaaatgccacagacatggattgaccgactcttgacaactttttat
ttctaccagatgacttgggaagaagaaagcggtatggttagattggtaacgtcttttgat
acaaaccttgaggaggttgaagatcttattaaggcaataaaagaactgaaccaaaataat
taa

DBGET integrated database retrieval system