KEGG   Clostridiales bacterium 70B-A: PATL70BA_2057Help
Entry
PATL70BA_2057     CDS       T05737                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00430  Taurine and hypotaurine metabolism
cbar00620  Pyruvate metabolism
cbar00640  Propanoate metabolism
cbar00680  Methane metabolism
cbar01100  Metabolic pathways
cbar01120  Microbial metabolism in diverse environments
cbar01200  Carbon metabolism
Module
cbar_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PATL70BA_2057 (ackA)
   00640 Propanoate metabolism
    PATL70BA_2057 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    PATL70BA_2057 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PATL70BA_2057 (ackA)
Enzymes [BR:cbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     PATL70BA_2057 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: VDN47940
UniProt: A0A3P7P332
Position
1:2072036..2073277
Genome map
AA seq 413 aa AA seqDB search
MGHYILALNCGSSSLKFTLFEVVKDNQLRSRMDGIVEEIGNKAHSRIKVESEAGKTVQDV
PLPSHHEALLAVFDCFHKEEIRDQDIVAVGHRVVHGGTAYSSSVRIDGAVIDKIRELFPL
APLHNPPNLLGIEVAMKLLEGVPQVAVFDTAFHATLPEAAYRYAIPKQWYEDFSVRTYGF
HGTSHMYVAKRGAKLLKIPYKDFYAITAHLGNGCSLTKIEAGKSTDTSMGFTPLEGVIMG
TRSGDIDPAIIDHVAHCLEKKEGLSLEAAYIKVMLALNKSSGLLALGGTNRMQDIREKAE
AGDVEAETVIAIYAYRIAKYIGAYWSTMPACQAIIFTAGVGENEGYVRKKVLDFLPALHF
KMDEDANKIRKEEVMIGKSDSSDLSVLVIPTDEESVIAYDALYLGYLGTSAPD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggacactatattttagcccttaactgtggcagctcctcattgaaattcacccttttt
gaggtggtgaaggacaatcaactaagaagtcgcatggatggtattgtagaagaaatcgga
aacaaagcacatagccgcatcaaagtagaaagtgaagctggtaaaacggtacaggatgta
ccgttgcccagccatcacgaagctttgcttgcggtttttgattgttttcataaggaagaa
ataagggaccaagatatcgtagcggtcggtcatcgggtggttcatggtggaactgcttat
agcagtagtgttagaatcgatggcgcagttattgataagattcgtgagctttttccctta
gcacccctgcataacccaccgaatcttctaggtatagaagtagccatgaagcttcttgaa
ggtgtgccccaagtggctgtttttgatacggcatttcatgctacattaccagaggcagct
tatcggtacgccataccaaaacaatggtatgaagactttagtgtaagaacctatggtttt
catggaacctctcatatgtatgtagccaagcgtggggctaagttattaaagataccttac
aaagatttttatgcgatcactgcccatcttggtaatggctgtagtctaactaagattgaa
gcaggtaaatccaccgataccagcatgggatttacaccccttgaaggggttattatgggt
acacgttcaggagatattgatccggccataatcgaccatgtagcacattgtctagagaag
aaagagggcctaagccttgaggcagcctatattaaggtcatgttagccctaaacaaatcc
agtggtctactagctcttggcggtaccaatcggatgcaggatattcgggaaaaagccgaa
gcgggcgatgtagaagccgagactgttattgccatctacgcctaccgcatcgccaaatat
attggggcttattggtcgacgatgcccgcttgtcaggcgattatttttaccgctggtgtt
ggagaaaatgaaggctatgtccgtaagaaagttcttgattttctcccggctcttcatttt
aagatggatgaggatgcaaataagatcaggaaagaagaagtgatgattgggaaatcggat
tcatcagatttatccgtactggtgatccctactgacgaggaaagtgttattgcttatgat
gccctttacctagggtatctaggaacaagcgcaccggattag

DBGET integrated database retrieval system