KEGG   Clostridiales bacterium 70B-A: PATL70BA_3256Help
Entry
PATL70BA_3256     CDS       T05737                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00030  Pentose phosphate pathway
cbar00480  Glutathione metabolism
cbar01100  Metabolic pathways
cbar01110  Biosynthesis of secondary metabolites
cbar01120  Microbial metabolism in diverse environments
cbar01130  Biosynthesis of antibiotics
cbar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PATL70BA_3256 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PATL70BA_3256 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbar04147]
    PATL70BA_3256 (zwf)
Enzymes [BR:cbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PATL70BA_3256 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PATL70BA_3256 (zwf)
Exosome [BR:cbar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PATL70BA_3256 (zwf)
  Exosomal proteins of colorectal cancer cells
   PATL70BA_3256 (zwf)
  Exosomal proteins of bladder cancer cells
   PATL70BA_3256 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: VDN49181
UniProt: A0A3P7Q1G3
Position
1:3323087..3324532
Genome map
AA seq 481 aa AA seqDB search
MENQKVIFTIFGGTGDLTYYKLIPAFYQLFLGGRILDDMTIIVLGRKNKDSASYREEVKE
VLMKKVSNYNENVFVAFSSKLHYYEMNFEKAEEYEGLNTFIDSKDCHNRIFYYATAPTFF
PFISEQLKDKKLLDVKGYARAVFEKPFGYDLESAEKINATVSKIFGEDHIFRIDHYLGKE
MIQNINTVRFSNQIFSAIWNKDSIDNIQITVKEKDGVKDRGGYYDKAGALRDMVQNHLIQ
ILALVAMEPPKNFNNNSAKEEKVKVIQNLSIQSELESHTNLIFGQYEGYRDEVKVDPDSN
TETFVAMKCFVNSKRWEGVPFYLKTGKALDESIAKIVIEFKTDGSSTPTNTEKIPNLLVI
KIQPEEGVYIRINTKEPRSESKLMSVNLSYCQSCDIFYKSPDAYERLLLDILNGDTAMFT
GWEEVKSAWELISEVVKKCPDKSKYLDTYSKGSDGPISSHDMLKRDGRHWWRVDDMNNNF
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcaaaaggtaatatttactatatttggtgggacaggtgatttaacttattac
aaactgatccctgctttttatcaattgtttttaggtggtcgtatattagatgatatgacc
atcattgtacttggcagaaagaataaagattcagcatcttatagagaagaagttaaagaa
gttttaatgaagaaagtatccaattataatgaaaatgtatttgtagcctttagttctaag
ttacattattatgaaatgaattttgaaaaagctgaagaatatgagggattaaataccttt
atagacagtaaagattgccataatcgcattttctactatgctacagcacctacttttttc
ccatttatatcggagcaacttaaggataagaagcttttagatgtgaaaggttatgcaaga
gccgtttttgaaaaaccctttggttatgatctagaatcagctgaaaaaatcaacgcaact
gtatcaaagattttcggagaggatcatatatttagaattgatcattatcttggcaaagaa
atgattcaaaacattaacaccgttcgattttccaatcaaatctttagtgctatctggaac
aaggactccattgacaatattcagataacagtaaaggaaaaagacggtgtaaaagataga
ggtggctactatgacaaagcaggcgcactaagagacatggtgcagaaccacctaatacag
attctagcgctcgtagctatggaacctccaaaaaactttaataataacagtgctaaggaa
gaaaaagtcaaagttattcagaatctgagcattcaatcggagttggaaagccatactaat
cttatattcggtcaatacgaaggatatagagatgaagtcaaggtagacccagactctaat
acagaaacttttgtcgccatgaaatgctttgtaaacagcaagcgatgggaaggggttcct
ttttatttaaagacaggcaaagcactagatgaaagtatagcaaaaattgtgattgagttt
aaaacggatgggtcaagtacaccaaccaatactgaaaaaatacctaatttgcttgttata
aaaatacaaccggaagaaggcgtgtatatacgcatcaatacaaaagaacctcgaagtgaa
agtaaattaatgtccgtcaatctaagttattgccaatcctgtgatattttttacaaatca
ccggatgcctatgaacgtttactgcttgacatcttaaatggtgatacagctatgtttact
ggatgggaagaagtaaaaagtgcatgggaactcatttcggaagtcgtaaaaaaatgtccg
gacaaatcaaaatatctggatacctattctaagggttcagatggcccgatctcatctcat
gatatgctaaaaagagatggtcgacattggtggcgtgtagatgatatgaataataatttt
gaataa

DBGET integrated database retrieval system