KEGG   Cellulophaga baltica 18: M666_02445Help
Entry
M666_02445        CDS       T03565                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00900  Terpenoid backbone biosynthesis
cbat01110  Biosynthesis of secondary metabolites
cbat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M666_02445
Enzymes [BR:cbat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     M666_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AIZ43638
UniProt: A0A0A7KGE6
Position
601725..603047
Genome map
AA seq 440 aa AA seqDB search
MNTPIEGFSKLTKEEKIAWIAKSYTTNSNETIAILKRYWNADETLQKLHDEFIENTITNY
YLPLGIAPNFLINDTLYAIPMAIEESSVVAAASKAAKFWLKRGGFKTTVINTEKVGQVHF
MYTGAFEKLESFFNLIAPKLKEDAKDITKNMEKRGGGITAITLRNKTAELENYYQLHCTF
ETLDAMGANFINSCLEQFAETLKNEFAKSPEFKEHEEQLEIVMSILSNYVPNCLVRAEVS
CPIEQLNEDNNSTAQDFAEKIVRAVQIAKVEPYRAVTHNKGIMNGIDAVVLATGNDFRAI
EAGIHAYAAKDGSYSSLTNASIENGIFKFWIEIPLALGTVGGLTGLHPLVKLALEILQNP
SAKDLMQIVAVAGLAQNFAAVRSLVTTGIQQGHMKMHLMNILNQLGASEGDKKTLVHHFK
HNTVTHSAVIAAYNSLQEKE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcctattgaaggattttccaagcttaccaaggaagaaaaaatagcttggata
gcgaaaagctatactacaaattctaacgaaacgattgccattttaaaaaggtattggaat
gctgacgaaacactacaaaaacttcatgatgagtttattgaaaataccataactaattat
tatttacctcttggtattgcaccaaattttcttattaacgataccctttatgccatacca
atggccattgaagaaagttctgtagtagctgcggctagtaaagcggctaaattttggtta
aagcgaggaggttttaagacaacggtaattaataccgaaaaagtaggacaggtacacttt
atgtatactggagcttttgagaaattggaatccttttttaatttgatagcccctaaatta
aaagaagacgccaaggatattaccaaaaacatggagaaacgtggaggtggtatcaccgcc
ataaccttacgtaataaaacagccgaattagaaaactactatcaactccattgcactttt
gaaaccctagatgccatgggggcaaatttcatcaattcttgtttggagcagtttgcagaa
acacttaagaatgaatttgctaaatcaccagaattcaaagaacatgaggagcagttagaa
attgtaatgagcatactaagcaactatgtacccaattgtttggtccgtgcagaagttagc
tgccctatagaacaactaaacgaagataacaatagtactgctcaagattttgctgaaaaa
attgttagagccgtgcaaattgcaaaagtagaaccataccgtgctgtgacacacaataaa
ggaatcatgaacggtattgatgctgttgttttagctacagggaacgactttagagccatt
gaagccggcatacacgcgtatgccgcgaaagatggaagttatagcagtttaactaatgct
agcatagaaaatggcatattcaaattttggattgaaattccacttgctttaggaacagta
ggcggactaacaggtttacatcctttggttaaattagccttagaaatacttcaaaatcct
tctgccaaagatttaatgcaaatagtagctgtagcaggtttagcacaaaattttgcagca
gtaagatccttagttactacaggaatacaacaaggacatatgaaaatgcacctgatgaat
atcctaaatcaattaggggcatctgaaggggataaaaaaactttagtacaccatttcaaa
cacaacactgttacacacagcgccgtaatagcagcttataatagtttacaagaaaaagaa
tga

DBGET integrated database retrieval system