KEGG   Cellulophaga baltica 18: M666_17530Help
Entry
M666_17530        CDS       T03565                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00040  Pentose and glucuronate interconversions
cbat00053  Ascorbate and aldarate metabolism
cbat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M666_17530
   00053 Ascorbate and aldarate metabolism
    M666_17530
Enzymes [BR:cbat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     M666_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIZ43196
UniProt: A0A0A7KAM8
Position
complement(4068854..4070437)
Genome map
AA seq 527 aa AA seqDB search
MISGKNYIGNKLSAKNTKTYKTFNPKTNTENTISFYEANQEEINEAVLLASNAFEAYKNI
SNEKKALFLNTIADEIVALDTALIDTYCSETGLTEGRVLGERGRTVGQLRMFADLVRQGN
WVDATIDTAIPDRVPMPKSDLRKMMVPLGPVVVFGASNFPLAYSTAGGDTASALASGCPV
IVKSHPMHAATGELVASAINKAAEITGMPNGVFSNLNSSGIEVGVALVQHPGVKAVGFTG
SIRGGSALFNLAAQREEPIPVFAEMGSINPVVILPKALAAKNEEWAKTYASSITLGSGQF
CTNPGLLLGISSDSLNKFIVHLSDEIVKIAPTCMLHPNIYKAYTTNKENAETQQGVVIAA
SFETKVADNYAKQAVTTVDGATFLKNSSLHHEVFGPYSMVVRCENAKELEAVIAALEGQL
TGTVIAEENDAENYVEIINALKNRVGRIIYNGVPTGVEVCPSMQHGGPYPASSDSRFSAV
GVHAIKRWIRPFSYQDWPNALLPLELQNENPLQLSRLVNGEQTTRSI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgatatctggaaaaaattatatagggaacaaattgtcggcaaaaaatacaaaaacgtac
aagacgtttaacccaaaaacgaacacggagaataccataagtttttacgaagcaaatcaa
gaggaaattaatgaagcggtgctattggcttcgaatgcttttgaagcttataagaatatt
tctaatgagaaaaaagccctatttttaaatacaatagcagatgaaatagtagcattagat
actgcgcttatagatacgtattgttctgaaacaggacttacggaagggagagtattagga
gaaagaggaagaaccgtagggcaactgcgtatgtttgcagatttggtgcgtcaaggaaat
tgggtagatgccactatagatacggccattccagacagagtgccaatgccaaaatcagat
ctacgtaagatgatggtgcccttaggacctgtagtagtatttggagcaagtaattttccg
ttggcctattctactgctggtggggataccgcttctgcattagcctctggttgtcctgta
attgttaaaagtcaccctatgcatgctgcaacaggagaactggttgcctcagctattaat
aaagcagcagaaataacaggcatgccaaatggtgtattttctaatcttaacagtagcgga
atagaagttggggttgctttggtgcaacatcctggtgttaaggcagttggttttacgggt
agtattagggggggtagcgctttatttaatttagcggcgcaaagagaggagcctattcct
gtatttgcagaaatggggagtattaaccctgtcgtgattttgcctaaggctttggccgcc
aaaaatgaagaatgggcaaagacttatgccagttccatcacattaggttcaggacaattt
tgtaccaatcctggattactattgggtattagcagtgactctttgaataaatttatagtg
cacttgtctgatgaaattgtaaaaatagctcccacatgtatgctgcatcctaatatttat
aaggcatatacgacgaataaggagaacgcagaaacacaacaaggagttgttatagcagcc
tcttttgaaactaaggtggcagataattatgcaaaacaagcagtaacaacggtagacggt
gctacattcttgaaaaactcaagcttgcatcatgaagtttttggaccctattctatggta
gtgcgctgtgagaatgcgaaagaattagaagcagttatagcagctctagaggggcaatta
accggtactgtaattgcagaggaaaatgatgcggaaaactatgttgaaataattaacgcc
ttaaaaaatagagtggggcgtatcatctataatggggtgcctacgggagtagaagtttgt
ccatctatgcaacatggggggccatatcctgcatcttcagatagtaggttttctgctgta
ggagtacatgctataaaaagatggattagacctttttcatatcaggactggccaaatgcc
ttattacctttagaattacaaaatgaaaacccgctgcaattaagtagattggtaaacgga
gagcaaactacaagatctatctaa

DBGET integrated database retrieval system