KEGG   Clostridium botulinum B1 Okra: CLD_1034
Entry
CLD_1034          CDS       T00671                                 

Gene name
rplN
Definition
(GenBank) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLD_1034 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbb03011]
    CLD_1034 (rplN)
Ribosome [BR:cbb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLD_1034 (rplN)
  Bacteria
    CLD_1034 (rplN)
  Archaea
    CLD_1034 (rplN)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-ProteinID: ACA43285
UniProt: B1IGE4
Position
complement(3772980..3773348)
AA seq 122 aa
MIQQQTRLKVADNSGAKEIMCIRVLGGSHRKWGNIGDVIVASVKSATPGGVVKKGEVVKA
VIVRSVKGLRRADGSYIKFDENAAVIIKDDKNPKGTRIFGPVARELRDKEFNKILSLAPE
VL
NT seq 369 nt   +upstreamnt  +downstreamnt
atgattcagcaacaaacaagattaaaggtagcagataattccggagcaaaggaaattatg
tgtataagagttttaggtggttcccacagaaaatggggaaatatcggagatgtaatagtt
gctagcgttaaaagtgcaacaccaggcggtgttgttaaaaaaggtgaagttgtaaaggct
gttatagtaagatcagttaaaggattaagaagagcagatggttcttacataaaatttgat
gaaaatgcagcagttataataaaagatgataaaaacccaaaaggaactcgtatttttgga
ccagttgcaagggagctaagagataaagagttcaataaaatactatcattagcacctgaa
gttttataa

DBGET integrated database retrieval system