KEGG   Clostridium botulinum B1 Okra: CLD_1331Help
Entry
CLD_1331          CDS       T00671                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00071  Fatty acid degradation
cbb00280  Valine, leucine and isoleucine degradation
cbb00310  Lysine degradation
cbb00362  Benzoate degradation
cbb00380  Tryptophan metabolism
cbb00620  Pyruvate metabolism
cbb00630  Glyoxylate and dicarboxylate metabolism
cbb00640  Propanoate metabolism
cbb00650  Butanoate metabolism
cbb00900  Terpenoid backbone biosynthesis
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01120  Microbial metabolism in diverse environments
cbb01130  Biosynthesis of antibiotics
cbb01200  Carbon metabolism
cbb01212  Fatty acid metabolism
cbb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLD_1331
   00630 Glyoxylate and dicarboxylate metabolism
    CLD_1331
   00640 Propanoate metabolism
    CLD_1331
   00650 Butanoate metabolism
    CLD_1331
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLD_1331
   00072 Synthesis and degradation of ketone bodies
    CLD_1331
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLD_1331
   00310 Lysine degradation
    CLD_1331
   00380 Tryptophan metabolism
    CLD_1331
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLD_1331
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLD_1331
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLD_1331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbb04147]
    CLD_1331
Enzymes [BR:cbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLD_1331
Exosome [BR:cbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLD_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACA43731
UniProt: B1IN20
Position
complement(3477239..3478417)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggtcaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggcgatggaaaaattgta
gacgagatgataagagatggactatgggaatcttttaatgactatcatatgggaattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagctttcaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttattatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaattcaaaacatggcttagctaccttatgtataggt
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system