KEGG   Clostridium botulinum B1 Okra: CLD_2951Help
Entry
CLD_2951          CDS       T00671                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00010  Glycolysis / Gluconeogenesis
cbb00052  Galactose metabolism
cbb00500  Starch and sucrose metabolism
cbb00520  Amino sugar and nucleotide sugar metabolism
cbb00521  Streptomycin biosynthesis
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01120  Microbial metabolism in diverse environments
cbb01130  Biosynthesis of antibiotics
cbb01200  Carbon metabolism
Module
cbb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_2951
   00052 Galactose metabolism
    CLD_2951
   00500 Starch and sucrose metabolism
    CLD_2951
   00520 Amino sugar and nucleotide sugar metabolism
    CLD_2951
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLD_2951
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLD_2951
Enzymes [BR:cbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLD_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N IF2_N DUF2067 DUF460
Motif
Other DBs
NCBI-ProteinID: ACA43878
UniProt: B1ILD9
Position
1776290..1777237
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGEGKGTKNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKVSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaggga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggggtaaac
ttagaagaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactctagctgaa
tttatgtttggtgaaggaaaaggtaccaagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgtgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataaggtttcaaaggaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacctttgatccagaaatggttgtcataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagcg
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system