KEGG   Clostridium botulinum B1 Okra: CLD_2980Help
Entry
CLD_2980          CDS       T00671                                 

Gene name
hisF
Definition
(GenBank) imidazoleglycerol phosphate synthase, cyclase subunit
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00340  Histidine metabolism
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01230  Biosynthesis of amino acids
Module
cbb_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CLD_2980 (hisF)
Enzymes [BR:cbb01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     CLD_2980 (hisF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus TMP-TENI G3P_antiterm IMPDH DHO_dh PcrB
Motif
Other DBs
NCBI-ProteinID: ACA46043
UniProt: B1ILB0
Position
1743779..1744540
Genome map
AA seq 253 aa AA seqDB search
MITKRIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRA
TMIDVVRKTAEKLFIPLTVGGGIKNINDFKDILRAGADKISVNSSAIRNPKLIKKAAECF
GSQCVVVAIDGKKRKDKDGWNVFINGGRIDTGLDAIEWARKVEKLGAGEILLTSMDADGT
KEGYDLELTNEVSKAVNIPVIASGGCGKLKHFGEIFEKSSADAALAASLFHFKELSIKEV
KNYLKEEGFSVRL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgattacaaagaggataataccttgcttagatgtagatatggggagagttgtaaaggga
gttaattttgttaatctaaaggatgtaggtgatcctgtagaaatagcagagttttataac
aaagaaggagcagatgaaatagtatttctagatatatcagctactcatgaaggaagagct
acaatgatagatgtggttagaaaaacagcagagaaactatttatccctcttactgtagga
gggggaattaaaaatataaatgatttcaaagatatattaagagctggggcagataaaata
tcagttaattcatccgctataagaaatcctaaacttataaaaaaggcagcagaatgtttt
ggatcacaatgtgttgtagtggctatagatggtaaaaaacgaaaagataaggatggatgg
aatgtatttataaatggaggcagaatagatacaggccttgatgctatagagtgggcaaga
aaggttgagaaattaggagccggtgagatattactcacaagtatggatgcagatggtaca
aaagaaggttatgatttagagcttacaaatgaagtttcaaaggcagtaaatattcctgta
attgcttcaggaggatgcggaaaactgaaacattttggagaaatttttgaaaaaagttca
gcagatgcagcattagcagcttccttatttcattttaaagaattaagcataaaggaagtt
aaaaactatttaaaagaagaaggctttagtgtaagactttag

DBGET integrated database retrieval system