KEGG   Clostridium botulinum B1 Okra: CLD_3281
Entry
CLD_3281          CDS       T00671                                 

Definition
(GenBank) putative xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00230  Purine metabolism
cbb01100  Metabolic pathways
cbb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLD_3281
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ACA43525
UniProt: B1IJQ4
Position
1415578..1416051
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagttaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagcgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagccattttaaaaagaaaatag

DBGET integrated database retrieval system